Peptides  >  Neuropeptides
 Product Size Catalog # US$  
26Rfa, Hypothalamic Peptide, human
TSGPLGNLAEELNGYSRKKGGFSFRF - NH2
1 mg AS-61651 $215
26Rfa, Hypothalamic Peptide, rat
ASGPLGTLAEELSSYSRRKGGFSFRF - NH2
1 mg AS-61650 $215
ClearPoint™ beta - Amyloid (1 - 38), 13C - Phe & Ile, Human
DAEFRHDSGYEVHHQKLV - *F - *F - AEDVGSNKGA - *I - *I - GLMVGG *F=Phe(U - 13C9), *I=Ile(U - 13C6)
0.05 mg AS-65220 $117
GAD65 (206 - 220)
TYEIAPVFVLLEYVT
1 mg AS-61515 $110
Glutamate Receptor Endocytosis Inhibitor, GluR23Y
YKEGYNVYG
1 mg AS-62547 $71
LCMV GP61
GLNGPDIYKGVYQFKSVEFD
1 mg AS-64560 $121
LCMV NP396 H - 2Db peptide
FQPQNGQFI
1 mg AS-61700 $71
MBP (84 - 105)
VVHFFKNIVTPRTPPPSQGKGR
1 mg AS-62739 $181
MOG (35 - 55), mouse, rat
MEVGWYRSPFSRVVHLYRNGK
1 mg AS-60130-1 $140
MOG (35 - 55), mouse, rat
MEVGWYRSPFSRVVHLYRNGK
5 mg AS-60130-5 $440
MOG (92 - 106)
DEGGYTCFFRDHSYQ
1 mg AS-62732 $93
Neuropeptide S, NPS, human
SFRNGVGTGMKKTSFQRAKS
1 mg AS-61243 $121
Neuropeptide S, NPS, mouse
SFRNGVGSGAKKTSFRRAKQ
1 mg AS-61246 $121
Neurotensin
pE - LYENKPRRPYIL
1 mg AS-62677 $83
P0 (180 - 199)
Peripheral Myelin P0 Protein (180 - 199), mouse
1 mg AS-65470 $161
P2 (53 - 78)
Peripheral Myelin Protein P2 (53 - 78), bovine
1 mg AS-65472 $242
pMOG (44 - 54)
FSRVVHLYRNG
1 mg AS-61620 $83
Secretoneurin
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
1 mg AS-62673 $286
  < Back