Peptides  >  Neuropeptides
 Product Size Catalog # US$  
β - Amyloid (12 - 24), Human
VHHQKLVFFAEDV
VHHQKLVFFAEDV
1 mg 62883 $83
β - Amyloid (13 - 23), Human
HHQKLVFFAED
HHQKLVFFAED
1 mg 62882 $77
[Ala16,17,20] - β - Amyloid (1 - 28), Human
DAEFRHDSGYEVHHQAAVFAAEDVGSNK
DAEFRHDSGYEVHHQAAVFAAEDVGSNK
1 mg 62890 $225
26Rfa, Hypothalamic Peptide, human
TSGPLGNLAEELNGYSRKKGGFSFRF - NH2
TSGPLGNLAEELNGYSRKKGGFSFRF - NH2
1 mg 61651 $215
26Rfa, Hypothalamic Peptide, rat
ASGPLGTLAEELSSYSRRKGGFSFRF - NH2
ASGPLGTLAEELSSYSRRKGGFSFRF - NH2
1 mg 61650 $215
Beta - Amyloid (13 - 22), Human
HHQKLVFFAE
HHQKLVFFAE
1 mg 62894 $77
Brain Neuropeptide I
AGEGLSSPFWSLAAPQRF - NH2
AGEGLSSPFWSLAAPQRF - NH2
1 mg 61647 $110
Brain Neuropeptide II
FLFQPPRF - NH2
FLFQPPRF - NH2
1 mg 61648 $71
Catestatin, Chromogranin A (352 - 372), human
SSMKLSFRARAYGFRGPGPQ
SSMKLSFRARAYGFRGPGPQ
1 mg 62433 $143
Cerebellin
SGSAKVAFSAIRSTNH
SGSAKVAFSAIRSTNH
1 mg 61172 $99
ClearPoint™ beta - Amyloid (1 - 38), 13C - Phe & Ile, Human
DAEFRHDSGYEVHHQKLV - *F - *F - AEDVGSNKGA - *I - *I - GLMVGG *F=Phe(U - 13C9), *I=Ile(U - 13C6)
DAEFRHDSGYEVHHQKLV - *F - *F - AEDVGSNKGA - *I - *I - GLM
VGG *F=Phe(U - 13C9), *I=Ile(U - 13C6)
0.05 mg 65220 $117
ClearPoint™ beta - Amyloid (1 - 40), 13C - Leu, Human
DAEFRHDSGYEVHHQK - L* - VFFAEDVGSNKGAIIG - L* - MVGGVV L*=Leu(U - 13C6)
DAEFRHDSGYEVHHQK - L* - VFFAEDVGSNKGAIIG - L* - MVGGV
V L*=Leu(U - 13C6)
0.05 mg 65221 $117
Erythropoietin, Human (hEPO) Fragment
MEVGQQAVEVWQGLALLSEAVLR
MEVGQQAVEVWQGLALLSEAVLR
1 mg 62562 $187
GAD65 (206 - 220)
TYEIAPVFVLLEYVT
TYEIAPVFVLLEYVT
1 mg 61515 $110
Galanin Like Peptide (GALP), human
APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS
APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLW
KAIDGLPYSHPPQPS
0.5 mg 61845-05 $281
Glutamate Receptor Endocytosis Inhibitor, GluR23Y
YKEGYNVYG
YKEGYNVYG
1 mg 62547 $71
LCMV GP61
GLNGPDIYKGVYQFKSVEFD
GLNGPDIYKGVYQFKSVEFD
1 mg 64560 $121
LCMV NP396 H - 2Db peptide
FQPQNGQFI
FQPQNGQFI
1 mg 61700 $71
MBP (84 - 105)
VVHFFKNIVTPRTPPPSQGKGR
VVHFFKNIVTPRTPPPSQGKGR
1 mg 62739 $181
MOG (101 - 120), human, mouse
RDHSYQEEAAMELKVEDPFY
RDHSYQEEAAMELKVEDPFY
1 mg 62370 $121
MOG (35 - 52)
MEVGWYRSPFSRVVHLYR
MEVGWYRSPFSRVVHLYR
1 mg 61603 $110
MOG (35 - 55), mouse, rat
MEVGWYRSPFSRVVHLYRNGK
MEVGWYRSPFSRVVHLYRNGK
1 mg 60130-1 $140
MOG (35 - 55), mouse, rat
MEVGWYRSPFSRVVHLYRNGK
MEVGWYRSPFSRVVHLYRNGK
5 mg 60130-5 $440
MOG (40–54)
YRSPFSRVVHLYRNG
YRSPFSRVVHLYRNG
1 mg 61626 $93
MOG (43–54)
PFSRVVHLYRNG
PFSRVVHLYRNG
1 mg 61610 $83
MOG (45 - 54)
SRVVHLYRNG
SRVVHLYRNG
1 mg 61611 $71
MOG (8 - 21)
PGYPIRALVGDEAE
PGYPIRALVGDEAE
1 mg 62369 $93
MOG (91 - 108), rat
SDEGGYTCFFRDHSYQEE
SDEGGYTCFFRDHSYQEE
1 mg 62735 $110
MOG (91 - 114), rat
SDEGGYTCFFRDHSYQEEAAVELK
SDEGGYTCFFRDHSYQEEAAVELK
1 mg 62738 $198
MOG (92–106)
DEGGYTCFFRDHSYQ
DEGGYTCFFRDHSYQ
1 mg 62732 $93
Myelin Oligodendrocyte Basic Protein (16 - 37); MOBP16 - 37, mouse
QKFSEHFSIHCCPPFTFLNSKR
QKFSEHFSIHCCPPFTFLNSKR
1 mg 65124 $165
Neuropeptide NPW - 23 (Human)
WYKHVASPRYHTVGRAAGLLMGL
WYKHVASPRYHTVGRAAGLLMGL
1 mg 61653 $181
Neuropeptide S, NPS (1 - 10), rat
SFRNGVGSGV
SFRNGVGSGV
1 mg 62599 $71
Neuropeptide S, NPS, human
SFRNGVGTGMKKTSFQRAKS
SFRNGVGTGMKKTSFQRAKS
1 mg 61243 $121
Neuropeptide S, NPS, mouse
SFRNGVGSGAKKTSFRRAKQ
SFRNGVGSGAKKTSFRRAKQ
1 mg 61246 $121
Neurotensin
QLYENKPRRPYIL
QLYENKPRRPYIL
1 mg 62677 $83
NPVF
VPNLPQRF - NH2
VPNLPQRF - NH2
1 mg 62006 $71
P0 (106 - 125)  NEW
Peripheral Myelin Protein P0 (106 - 125), mouse
IVGKTSQVTLYVFEKVPTRY
1 mg 65469 $161
P0 (180 - 199)  NEW
Peripheral Myelin P0 Protein (180 - 199), mouse
SSKRGRQTPVLYAMLDHSRS
1 mg 65470 $161
P0 (56 - 71)  NEW
Peripheral Myelin Protein P0 (56 - 71), rat
GQPYIDEVGTEKERIQ
1 mg 65471 $113
P2 (53 - 78)  NEW
Peripheral Myelin Protein P2 (53 - 78), bovine
TESPFKNTEISFKLGQEFEETTADNR
1 mg 65472 $242
pMOG (44 - 54)
FSRVVHLYRNG
FSRVVHLYRNG
1 mg 61620 $83
Proctolin
RYLPT
RYLPT
1 mg 61248 $44
QF - ERP7, FRET
Abz - GGFLRRV - EDDnp
Abz - GGFLRRV - EDDnp
0.5 mg 62728 $143
Secretoneurin
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
1 mg 62673 $286
Urocotin III; Stresscopin (SCP) (3 - 40), mouse
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI - NH2
FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI - NH2
0.5 mg 64393-05 $303
VGF Protein Precursor (491 - 507)
PPEPVPPPRAAPAPTHV
PPEPVPPPRAAPAPTHV
1 mg 62703 $105
WE - 14
WSRMDQLAKELTAE
WSRMDQLAKELTAE
1 mg 62672 $93
  < Back