Peptides  >  Ion Channel Peptides
 Product Size Catalog # US$  
GALA, Pore - Forming Peptide
WEAALAEALAEALAEHLAEALAEALEALAA
1 mg AS-62311 $237
Ryanodine receptor 1 (RyR1) (3614 - 3643); Calmodulin Binding Peptide (CaMBP)
KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
1 mg AS-64606 $220
  < Back