Peptides  >  Histones  >  Histone H3 Peptides
Chromatin exist either as the transcriptionally active euchromatin or as the transcriptionally repressed heterchromatin state.1 Post-translational modifications of histone “tails” (amino termini) have been implicated in the conversion between the two states. 1-2 Covalent modifications, such as acetylation, methylation and phosphorylation affect chromatin structure and exquisitely regulate gene expression.3-6 Histone hyperacetylation is correlated with increased transcription, whereas hypoacetylation correlates with transcriptional repression.5 In Histone H3, preferential methylation sites have been shown to be Lys-4, Lys-9, Lys-27 and Lys-36, with methylation generally leading to transcriptional suppression.3,7 Phosphorylation at Ser10 (pSer10) is implicated in both transcription and cell division.8

AnaSpec, the world’s largest provider of on-demand GO™ peptides is pleased to announce the rapid expansion of our histone H3 peptide selection. These new Histone H3 GO™ Peptides include sequences that are acetylated, mono-, di- or tri-methylated, phosphorylated and biotinylated.

References:

1. Grunstein, M. et al. J. Cell Sci. Suppl. 19, 29 (1995).
2. Strahl, BR and CD Allis, Nature 403, 41 (2000).
3. Strahl, BD. et al. Proc. Natl. Acad. Sci. 96, 14967 (1999).
4. Jenuwein, T. and CD. Allis Science 293, 1074 (2001).
5. Sterner, DE. et al. Microbiol. Mol. Biol. Rev. 64, 435 (2000).
6. Lachner, M. et al. J. Cell Sci. 116, 2117 (2003).
7. Nishioka, K. et al. Genes & Dev. 16, 479 (2002).
8. Prigent, C. and S. Dimitrov, J. Cell Sci. 116, 3677 (2003).
 Product Size Catalog # US$  
Histone H3 (1 - 8)
ARTKQTAR
ARTKQTAR
1 mg 65152 $71
Histone H3 (73 - 83)  NEW
EIAQDFKTDLR
EIAQDFKTDLR
1 mg 65437-1 $42
Histone H3 (73 - 83)  NEW
EIAQDFKTDLR
EIAQDFKTDLR
5 mg 65437-5 $104
[Lys(Ac)79] - Histone H3 (73 - 83), H3K79(Ac)  NEW
EIAQDF - K(Ac) - TDLR
EIAQDF - K(Ac) - TDLR
1 mg 65438-1 $104
[Lys(Ac)79] - Histone H3 (73 - 83), H3K79(Ac)  NEW
EIAQDF - K(Ac) - TDLR
EIAQDF - K(Ac) - TDLR
5 mg 65438-5 $259
[Lys(Me3)79] - Histone H3(73 - 83), H3K79(Me3)  NEW
EIAQDF - K(Me3) - TDLR
EIAQDF - K(Me3) - TDLR
1 mg 65439-1 $102
[Lys(Me3)79] - Histone H3(73 - 83), H3K79(Me3)  NEW
EIAQDF - K(Me3) - TDLR
EIAQDF - K(Me3) - TDLR
5 mg 65439-5 $357
[Lys(biotin)79] - Histone H3 (73 - 83), H3K79(biotin), Biotinylated  NEW
EIAQDF - K(biotin) - TDLR
EIAQDF - K(biotin) - TDLR
0.25 mg 65440-025 $64
[Lys(biotin)79] - Histone H3 (73 - 83), H3K79(biotin), Biotinylated  NEW
EIAQDF - K(biotin) - TDLR
EIAQDF - K(biotin) - TDLR
1 mg 65440-1 $128
[Lys(Ac)79] - Histone H3 (69 - 89), H3K79(Ac), biotin - labeled  NEW
RLVREIAQDF - K(Ac) - TDLRFQSSAV - K(biotin)
RLVREIAQDF - K(Ac) - TDLRFQSSAV - K(biotin)
0.25 mg 65441-025 $163
[Lys(Ac)79] - Histone H3 (69 - 89), H3K79(Ac), biotin - labeled  NEW
RLVREIAQDF - K(Ac) - TDLRFQSSAV - K(biotin)
RLVREIAQDF - K(Ac) - TDLRFQSSAV - K(biotin)
1 mg 65441-1 $325
[Lys(Ac)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Ac)K36(Me1), biotin - labeled  NEW
ATKAAR - K(Ac) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin)
ATKAAR - K(Ac) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Biot
in)
0.25 mg 65444-025 $167
[Lys(Ac)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Ac)K36(Me1), biotin - labeled  NEW
ATKAAR - K(Ac) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin)
ATKAAR - K(Ac) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Biot
in)
1 mg 65444-1 $335
[Lys(Ac)27, Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Ac)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Ac) - SAPATGGV - K(Me2) - KPHRYRPG - GK(Biotin)
ATKAAR - K(Ac) - SAPATGGV - K(Me2) - KPHRYRPG - GK(Biot
in)
0.25 mg 65445-025 $250
[Lys(Ac)27, Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Ac)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Ac) - SAPATGGV - K(Me2) - KPHRYRPG - GK(Biotin)
ATKAAR - K(Ac) - SAPATGGV - K(Me2) - KPHRYRPG - GK(Biot
in)
1 mg 65445-1 $501
[Lys(Me1)27/36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1)K36(Me1),  NEW
ATKAAR - K(Me1) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin
ATKAAR - K(Me1) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Bio
tin
0.25 mg 65446-025 $200
[Lys(Me1)27/36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1)K36(Me1),  NEW
ATKAAR - K(Me1) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin
ATKAAR - K(Me1) - SAPATGGV - K(Me1) - KPHRYRPG - GK(Bio
tin
1 mg 65446-1 $401
[Lys(Me1)27, Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Me1) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Biotin)
ATKAAR - K(Me1) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Bio
tin)
1 mg 65447-1 $190
[Lys(Me1)27, Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Me1) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Biotin)
ATKAAR - K(Me1) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Bio
tin)
5 mg 65447-5 $440
[Lys(Me2)27/36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me2)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Me2) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Biotin)
ATKAAR - K(Me2) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Bio
tin)
1 mg 65448-1 $240
[Lys(Me2)27/36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me2)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Me2) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Biotin)
ATKAAR - K(Me2) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Bio
tin)
5 mg 65448-5 $540
[Lys(Me2)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me2)K36(Me1), biotin - labeled  NEW
ATKAAR - K(Me2) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Biotin)
ATKAAR - K(Me2) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Bio
tin)
1 mg 65449-1 $190
[Lys(Me2)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me2)K36(Me1), biotin - labeled  NEW
ATKAAR - K(Me2) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Biotin)
ATKAAR - K(Me2) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Bio
tin)
5 mg 65449-5 $440
[Lys(Me3)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3)K36(Me1), biotin - labeled  NEW
ATKAAR - K(Me3) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Biotin)
ATKAAR - K(Me3) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Bio
tin)
1 mg 65450-1 $240
[Lys(Me3)27, Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3)K36(Me1), biotin - labeled  NEW
ATKAAR - K(Me3) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Biotin)
ATKAAR - K(Me3) - SAPATGGV - K(Me1) - KPHRYRPGG - K(Bio
tin)
5 mg 65450-5 $540
[Lys(Me3)27, Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Me3) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Biotin)
ATKAAR - K(Me3) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Bio
tin)
1 mg 65451-1 $270
[Lys(Me3)27, Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3)K36(Me2), biotin - labeled  NEW
ATKAAR - K(Me3) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Biotin)
ATKAAR - K(Me3) - SAPATGGV - K(Me2) - KPHRYRPGG - K(Bio
tin)
5 mg 65451-5 $620
[Lys(Me1)4] - Histone H3 (1 - 10), H3K4(Me1)
ART - K(Me1) - QTARKS
ART - K(Me1) - QTARKS
1 mg 64369-1 $176
[Lys(Me2)4] - Histone H3 (1 - 10), H3K4(Me2)
ART - K(Me2) - QTARKS
ART - K(Me2) - QTARKS
1 mg 64370-1 $176
[Lys(Me3)4] - Histone H3 (1 - 10), H3K4(Me3)
ART - K(Me3) - QTARKS
ART - K(Me3) - QTARKS
1 mg 64371-1 $176
[pSer10] - Histone H3 (1 - 15); H3pS10
ARTKQTARK - pS - TGGKA
ARTKQTARK - pS - TGGKA
0.5 mg 65128 $95
Histone H3 (1 - 18) - WC, amide
ARTKQTARKSTGGKAPRKWC - NH2
ARTKQTARKSTGGKAPRKWC - NH2
1 mg 65052 $110
[Lys(Ac)14] - Histone H3 (1 - 19), H3K14(Ac)
ARTKQTARKSTGG - K(Ac) - APRKQ
ARTKQTARKSTGG - K(Ac) - APRKQ
1 mg 63682 $181
Histone H3 (1 - 20), N - Terminal
ARTKQTARKSTGGKAPRKQL
ARTKQTARKSTGGKAPRKQL
1 mg 62753 $121
[Lys(Ac)9] - Histone H3 (1 - 20), H3K9(Ac)
ARTKQTAR - K(Ac) - STGGKAPRKQL
ARTKQTAR - K(Ac) - STGGKAPRKQL
1 mg 63680 $181
Histone H3 (1 - 21), Biotinylated
ARTKQTARKSTGGKAPRKQLA - GG - K(BIOTIN) - NH2
ARTKQTARKSTGGKAPRKQLA - GG - K(BIOTIN) - NH2
1 mg 61702 $225
Histone H3 (1 - 21), FAM labeled
ARTKQTARKSTGGKAPRKQLAGG - K(FAM) - NH2
ARTKQTARKSTGGKAPRKQLAGG - K(FAM) - NH2
1 mg 63824 $313
Histone H3 (1 - 21), N - Terminal
ARTKQTARKSTGGKAPRKQLA
ARTKQTARKSTGGKAPRKQLA
1 mg 61701 $176
Histone H3 (1 - 21) - Cys
ARTKQTARKSTGGKAPRKQLAC
ARTKQTARKSTGGKAPRKQLAC
1 mg 63789 $181
[Arg(Me1)2] - Histone H3 (1 - 21) - GGK(Biotin), H3R2(Me1), biotin - labeled
A - R(Me1) - TKQTARKSTGGKAPRKQLAGG - K(Biotin) - NH2
A - R(Me1) - TKQTARKSTGGKAPRKQLAGG - K(Biotin) - NH2
0.25 mg 64629-025 $115
[Arg(Me1)2] - Histone H3 (1 - 21) - GGK(Biotin), H3R2(Me1), biotin - labeled
A - R(Me1) - TKQTARKSTGGKAPRKQLAGG - K(Biotin) - NH2
A - R(Me1) - TKQTARKSTGGKAPRKQLAGG - K(Biotin) - NH2
1 mg 64629-1 $335
[Arg(Me2a)2] - Histone H3 (1 - 21) - GGK(Biotin), H3R2(Me2a), biotin - labeled
A - R(Me2a) - TKQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
A - R(Me2a) - TKQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
0.25 mg 64630-025 $143
[Arg(Me2a)2] - Histone H3 (1 - 21) - GGK(Biotin), H3R2(Me2a), biotin - labeled
A - R(Me2a) - TKQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
A - R(Me2a) - TKQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
1 mg 64630-1 $385
[Arg(Me2a)2, Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - T - K(Me2) - QTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2a) - T - K(Me2) - QTARKSTGGKAPRKQLAGG - K(Biot
in)
0.25 mg 65264-025 $145
[Arg(Me2a)2, Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - T - K(Me2) - QTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2a) - T - K(Me2) - QTARKSTGGKAPRKQLAGG - K(Biot
in)
1 mg 65264-1 $395
[Arg(Me2s)2] - Histone H3 (1 - 21) - GGK(Biotin); H3R2(Me2s), biotin - labeled
A - R(Me2s) - TKQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
A - R(Me2s) - TKQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
0.25 mg 64631-025 $143
[Arg(Me2s)2] - Histone H3 (1 - 21) - GGK(Biotin); H3R2(Me2s), biotin - labeled
A - R(Me2s) - TKQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
A - R(Me2s) - TKQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
1 mg 64631-1 $385
[Arg(Me2a)2, Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - T - K(Me3) - QTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2a) - T - K(Me3) - QTARKSTGGKAPRKQLAGG - K(Biot
in)
0.25 mg 65265-025 $159
[Arg(Me2a)2, Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - T - K(Me3) - QTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2a) - T - K(Me3) - QTARKSTGGKAPRKQLAGG - K(Biot
in)
1 mg 65265-1 $435
[Arg(Me2a)2, pThr3] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2a) - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg 65266-025 $159
[Arg(Me2a)2, pThr3] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2a) - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg 65266-1 $435
[Arg(Me2s)2, Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - T - K(Ac) - QTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2s) - T - K(Ac) - QTARKSTGGKAPRKQLAGG - K(Bioti
n)
0.25 mg 65267-025 $159
[Arg(Me2s)2, Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - T - K(Ac) - QTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2s) - T - K(Ac) - QTARKSTGGKAPRKQLAGG - K(Bioti
n)
1 mg 65267-1 $435
[Arg(Me2s)2, Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - T - K(Me2) - QTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2s) - T - K(Me2) - QTARKSTGGKAPRKQLAGG - K(Biot
in)
0.25 mg 65269-025 $159
[Arg(Me2s)2, Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - T - K(Me2) - QTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2s) - T - K(Me2) - QTARKSTGGKAPRKQLAGG - K(Biot
in)
1 mg 65269-1 $435
[Arg(Me2s)2, Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - T - K(Me3) - QTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2s) - T - K(Me3) - QTARKSTGGKAPRKQLAGG - K(Biot
in)
1 mg 65270-1 $435
[Arg(Me2s)2, Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - T - K(Me3) - QTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2s) - T - K(Me3) - QTARKSTGGKAPRKQLAGG - K(Biot
in)
0.25 mg 65270-025 $159
[Arg(Me2a)2, Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - T - K(Ac) - QTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2a) - T - K(Ac) - QTARKSTGGKAPRKQLAGG - K(Bioti
n)
1 mg 65262-1 $395
[Arg(Me2a)2, Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2a) - T - K(Ac) - QTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2a) - T - K(Ac) - QTARKSTGGKAPRKQLAGG - K(Bioti
n)
0.25 mg 65262-025 $145
[Arg(Me2s)2, pThr3] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2s) - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg 65271-025 $159
[Arg(Me2s)2, pThr3] - Histone H3 (1 - 21) - GGK(Biotin)
A - R(Me2s) - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
A - R(Me2s) - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg 65271-1 $435
[Cit2] - Histone H3 (1 - 21) - GGK(Biotin)
A - Cit - TKQTARKSTGGKAPRKQLAGG - K(Biotin)
A - Cit - TKQTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg 65237-025 $115
[Cit2] - Histone H3 (1 - 21) - GGK(Biotin)
A - Cit - TKQTARKSTGGKAPRKQLAGG - K(Biotin)
A - Cit - TKQTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg 65237-1 $335
[Cit 2/8/17] - Histone H3 (1 - 21) - GGK(Biotin), amide
A - Cit - TKQTA - Cit - KSTGGKAP - Cit - KQLAGG - K(Biotin) - NH2
A - Cit - TKQTA - Cit - KSTGGKAP - Cit - KQLAGG - K(Biotin)
- NH2
0.25 mg 65404 $250
[Cit2, pThr3] - Histone H3 (1 - 21) - GGK(Biotin)
A - Cit - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
A - Cit - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
0.25 mg 65272-025 $143
[Cit2, pThr3] - Histone H3 (1 - 21) - GGK(Biotin)
A - Cit - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
A - Cit - pT - KQTARKSTGGKAPRKQLAGG - K(Biotin)
1 mg 65272-1 $385
[pThr3] - Histone H3 (1 - 21) - GGK(Biotin); H3pT3, biotin - labeled
AR - pT - KQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
AR - pT - KQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
0.25 mg 64612-025 $143
[pThr3] - Histone H3 (1 - 21) - GGK(Biotin); H3pT3, biotin - labeled
AR - pT - KQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
AR - pT - KQTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
1 mg 64612-1 $385
[Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
ART - K(Ac) - QTARKSTGGKAPRKQLAGG - K(biotin)
ART - K(Ac) - QTARKSTGGKAPRKQLAGG - K(biotin)
0.25 mg 65207-025 $115
[Lys(Ac)4] - Histone H3 (1 - 21) - GGK(Biotin)
ART - K(Ac) - QTARKSTGGKAPRKQLAGG - K(biotin)
ART - K(Ac) - QTARKSTGGKAPRKQLAGG - K(biotin)
1 mg 65207-1 $335
Histone H3 (1 - 21), K4 methylated, FAM labeled
ART - K(Me) - QTARKSTGGKAPRKQLAGG - K(FAM) - NH2
ART - K(Me) - QTARKSTGGKAPRKQLAGG - K(FAM) - NH2
1 mg 63825 $357
[Lys(Me1)4] - Histone H3 (1 - 21), H3K4(Me1)
ART - K(Me1) - QTARKSTGGKAPRKQLA
ART - K(Me1) - QTARKSTGGKAPRKQLA
1 mg 64459 $297
[Lys(Me2)4] - Histone H3 (1 - 21), H3K4(Me2)
ART - K(Me2) - QTARKSTGGKAPRKQLA
ART - K(Me2) - QTARKSTGGKAPRKQLA
1 mg 63677 $225
[Lys(Me3)4] - Histone H3 (1 - 21), H3K4(Me3)
ART - K(Me3) - QTARKSTGGKAPRKQLA
ART - K(Me3) - QTARKSTGGKAPRKQLA
0.25 mg 64194-025 $115
[Lys(Me3)4] - Histone H3 (1 - 21), H3K4(Me3)
ART - K(Me3) - QTARKSTGGKAPRKQLA
ART - K(Me3) - QTARKSTGGKAPRKQLA
1 mg 64194 $297
[Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me3), biotin labeled
ART - K(Me3) - QTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
ART - K(Me3) - QTARKSTGGKAPRKQLA - GGK(Biotin) - NH2
1 mg 64192 $319
[Lys(Me1)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me1), biotin - labeled
ART - K(Me1) - QTARKSTGGKAPRKQLA - GGK(Biotin)
ART - K(Me1) - QTARKSTGGKAPRKQLA - GGK(Biotin)
0.25 mg 64355-025 $115
[Lys(Me1)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me1), biotin - labeled
ART - K(Me1) - QTARKSTGGKAPRKQLA - GGK(Biotin)
ART - K(Me1) - QTARKSTGGKAPRKQLA - GGK(Biotin)
1 mg 64355-1 $313
[Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me2), biotin - labeled
ART - K(Me2) - QTARKSTGGKAPRKQLA - GGK(Biotin)
ART - K(Me2) - QTARKSTGGKAPRKQLA - GGK(Biotin)
0.25 mg 64356-025 $115
[Lys(Me2)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me2), biotin - labeled
ART - K(Me2) - QTARKSTGGKAPRKQLA - GGK(Biotin)
ART - K(Me2) - QTARKSTGGKAPRKQLA - GGK(Biotin)
1 mg 64356-1 $286
[Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me3), biotin - labeled
ART - K(Me3) - QTARKSTGGKAPRKQLA - GGK(Biotin)
ART - K(Me3) - QTARKSTGGKAPRKQLA - GGK(Biotin)
0.25 mg 64357-025 $115
[Lys(Me3)4] - Histone H3 (1 - 21) - GGK(Biotin), H3K4(Me3), biotin - labeled
ART - K(Me3) - QTARKSTGGKAPRKQLA - GGK(Biotin)
ART - K(Me3) - QTARKSTGGKAPRKQLA - GGK(Biotin)
1 mg 64357-1 $313
[Lys(Me3)4(Ac)9] - Histone H3 (1 - 21), H3K4(Me3)K9(Ac)
ART - K(Me3) - QTAR - K(Ac) - STGGKAPRKQLA
ART - K(Me3) - QTAR - K(Ac) - STGGKAPRKQLA
1 mg 64188 $325
[Lys(Me3)4(Ac)9] - Histone H3 (1 - 21), H3K4(Me3)K9(Ac), Biotin labeled
ART - K(Me3) - QTAR - K(Ac) - STGGKAPRKQLAGG - K(Biotin) - NH2
ART - K(Me3) - QTAR - K(Ac) - STGGKAPRKQLAGG - K(Biotin
) - NH2
1 mg 64189 $357
[Lys (Me3) 4, Lys (Ac)9, pSer10] - Histone H3 (1 - 21)  NEW
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA
0.25 mg 65422-025 $143
[Lys (Me3)4, Lys (Ac)9, pSer10] - Histone H3 (1 - 21)  NEW
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA
1 mg 65422-1 $385
[Lys (Me3)4, Lys (Ac)9, pSer10] - Histone H3 (1 - 21) - GGK(Biotin)  NEW
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA - GGK(Biotin)
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA - GGK(Biot
in)
0.25 mg 65423-025 $145
[Lys (Me3)4, Lys (Ac)9, pSer10] - Histone H3 (1 - 21) - GGK(Biotin)  NEW
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA - GGK(Biotin)
ART - K(Me3) - QTAR - K(Ac) - pS - TGGKAPRKQLA - GGK(Biot
in)
1 mg 65423-1 $395
[Lys(Me3)4, Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin), biotin - labeled
ART - K(Me3) - QTARKSTGG - K(Ac) - APRKQLAGG - K(Biotin)
ART - K(Me3) - QTARKSTGG - K(Ac) - APRKQLAGG - K(Biotin
)
0.25 mg 65088-025 $143
[Lys(Me3)4, Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin), biotin - labeled
ART - K(Me3) - QTARKSTGG - K(Ac) - APRKQLAGG - K(Biotin)
ART - K(Me3) - QTARKSTGG - K(Ac) - APRKQLAGG - K(Biotin
)
1 mg 65088-1 $385
[Arg(Me1)8] - Histone H3 (1 - 21) - K(biotin), H3R8(Me1), biotin labeled
ARTKQTA - R(Me1) - KSTGGKAPRKQLA - K(Biotin) - NH2
ARTKQTA - R(Me1) - KSTGGKAPRKQLA - K(Biotin) - NH2
0.25 mg 64607-025 $143
[Arg(Me1)8] - Histone H3 (1 - 21) - K(Biotin), H3R8(Me1), biotin labeled
ARTKQTA - R(Me1) - KSTGGKAPRKQLA - K(Biotin) - NH2
ARTKQTA - R(Me1) - KSTGGKAPRKQLA - K(Biotin) - NH2
1 mg 64607-1 $385
[Arg(Me2a)8] - Histone H3(1 - 21) - K(Biotin), H3R8(Me2a), biotin - labeled
ARTKQTA - R(Me2a) - KSTGGKAPRKQLA - K(Biotin) - NH2
ARTKQTA - R(Me2a) - KSTGGKAPRKQLA - K(Biotin) - NH2
0.25 mg 64972-025 $143
[Arg(Me2a)8] - Histone H3(1 - 21) - K(Biotin), H3R8(Me2a), biotin - labeled
ARTKQTA - R(Me2a) - KSTGGKAPRKQLA - K(Biotin) - NH2
ARTKQTA - R(Me2a) - KSTGGKAPRKQLA - K(Biotin) - NH2
1 mg 64972-1 $385
[Arg(Me2s)8] - Histone H3 (1 - 21), biotin - labeled
ARTKQTA - R(Me2s) - KSTGGKAPRKQLA - K(Biotin)
ARTKQTA - R(Me2s) - KSTGGKAPRKQLA - K(Biotin)
1 mg 65351-1 $350
[Arg(Me2s)8] - Histone H3 (1 - 21), biotin - labeled
ARTKQTA - R(Me2s) - KSTGGKAPRKQLA - K(Biotin)
ARTKQTA - R(Me2s) - KSTGGKAPRKQLA - K(Biotin)
0.25 mg 65351-025 $130
[Cit8] - Histone H3 (1 - 21) - GGK(Biotin)
ARTKQTA - Cit - KSTGGKAPRKQLAGG - K(Biotin)
ARTKQTA - Cit - KSTGGKAPRKQLAGG - K(Biotin)
0.25 mg 65232-025 $115
[Cit8] - Histone H3 (1 - 21) - GGK(Biotin)
ARTKQTA - Cit - KSTGGKAPRKQLAGG - K(Biotin)
ARTKQTA - Cit - KSTGGKAPRKQLAGG - K(Biotin)
1 mg 65232-1 $335
[Lys(Ac)9] - Histone H3 (1 - 21), H3K9(Ac)
ARTKQTAR - K(Ac) - STGGKAPRKQLA
ARTKQTAR - K(Ac) - STGGKAPRKQLA
1 mg 64191 $203
[Lys(Ac)9] - Histone H3 (1 - 21) - NH2, H3K9(Ac), biotin - labeled, amide
ARTKQTAR - K(Ac) - STGGKAPRKQLA - GGK(Biotin) - NH2
ARTKQTAR - K(Ac) - STGGKAPRKQLA - GGK(Biotin) - NH2
1 mg 64190 $231
[Lys(Ac)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Ac), biotin - labeled
ARTKQTAR - K(Ac) - STGGKAPRKQLA - GGK(Biotin)
ARTKQTAR - K(Ac) - STGGKAPRKQLA - GGK(Biotin)
0.25 mg 64361-025 $115
[Lys(Ac)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Ac), biotin - labeled
ARTKQTAR - K(Ac) - STGGKAPRKQLA - GGK(Biotin)
ARTKQTAR - K(Ac) - STGGKAPRKQLA - GGK(Biotin)
1 mg 64361-1 $247
[Lys(Ac)9, pSer10] - Histone H3 (1 - 21)
ARTKQTAR - K(Ac) - pS - TGGKAPRKQLA
ARTKQTAR - K(Ac) - pS - TGGKAPRKQLA
0.25 mg 65203-025 $115
[Lys(Ac)9, pSer10] - Histone H3 (1 - 21)
ARTKQTAR - K(Ac) - pS - TGGKAPRKQLA
ARTKQTAR - K(Ac) - pS - TGGKAPRKQLA
1 mg 65203-1 $335
[Lys(Ac)9/14] - Histone H3 (1 - 21) - GGK(Biotin), H3K9/14(Ac), biotin - labeled
ARTKQTAR - K(Ac) - STGG - K(Ac) - APRKQLA - GGK(Biotin)
ARTKQTAR - K(Ac) - STGG - K(Ac) - APRKQLA - GGK(Biotin)
0.25 mg 64363-025 $115
[Lys(Ac)9/14] - Histone H3 (1 - 21) - GGK(Biotin), H3K9/14(Ac), biotin - labeled
ARTKQTAR - K(Ac) - STGG - K(Ac) - APRKQLA - GGK(Biotin)
ARTKQTAR - K(Ac) - STGG - K(Ac) - APRKQLA - GGK(Biotin)
1 mg 64363-1 $253
[Lys(Me1)9] - Histone H3 (1 - 21), biotin - labeled
ARTKQTAR - K(Me1) - STGGKAPRKQLA - K(Biotin)
ARTKQTAR - K(Me1) - STGGKAPRKQLA - K(Biotin)
1 mg 65349-1 $305
[Lys(Me1)9] - Histone H3 (1 - 21), biotin - labeled
ARTKQTAR - K(Me1) - STGGKAPRKQLA - K(Biotin)
ARTKQTAR - K(Me1) - STGGKAPRKQLA - K(Biotin)
0.25 mg 65349-025 $105
[Lys(Me1)9] - Histone H3 (1 - 21) - K(Biotin), H3K9(Me1), biotin - labeled, amide
ARTKQTAR - K(Me1) - STGGKAPRKQLA - K(Biotin) - NH2
ARTKQTAR - K(Me1) - STGGKAPRKQLA - K(Biotin) - NH2
0.25 mg 64539 $115
[Lys(Me1)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me1), biotin - labeled
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin)
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin)
0.25 mg 64358-025 $115
[Lys(Me1)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me1), biotin - labeled
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin)
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin)
1 mg 64358-1 $313
[Lys(Me1)9] - Histone H3 (1 - 21) - GGK(Biotin); H3K9(Me1), biotin - labeled, amide
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin) - NH2
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin) - NH2
0.25 mg 64626-025 $115
[Lys(Me1)9] - Histone H3 (1 - 21) - GGK(Biotin); H3K9(Me1), biotin - labeled, amide
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin) - NH2
ARTKQTAR - K(Me1) - STGGKAPRKQLA - GGK(Biotin) - NH2
1 mg 64626-1 $335
[Lys(Me2)9] - Histone H3 (1 - 21)
ARTKQTAR - K(Me2) - STGGKAPRKQLA
ARTKQTAR - K(Me2) - STGGKAPRKQLA
1 mg 65401 $210
[Lys(Me2)9] - Histone H3 (1 - 21) - K(Biotin), H3K9(Me2), biotin labeled
ARTKQTAR - K(Me2) - STGGKAPRKQLA - K(Biotin)
ARTKQTAR - K(Me2) - STGGKAPRKQLA - K(Biotin)
1 mg 63678 $242
[Lys(Me2)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me2), biotin - labeled
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin)
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin)
0.25 mg 64359-025 $115
[Lys(Me2)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me2), biotin - labeled
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin)
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin)
1 mg 64359-1 $286
[Lys(Me2)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me2), biotin - labeled, amide
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin) - NH2
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin) - NH2
0.25 mg 64627-025 $115
[Lys(Me2)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me2), biotin - labeled, amide
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin) - NH2
ARTKQTAR - K(Me2) - STGGKAPRKQLA - GGK(Biotin) - NH2
1 mg 64627-1 $335
[Lys(Me3)9] - Histone H3 (1 - 21), H3K9(Me3)
ARTKQTAR - K(Me3) - STGGKAPRKQLA
ARTKQTAR - K(Me3) - STGGKAPRKQLA
1 mg 64452 $225
[Lys(Me3)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me3), biotin - labeled
ARTKQTAR - K(Me3) - STGGKAPRKQLA - GGK(Biotin)
ARTKQTAR - K(Me3) - STGGKAPRKQLA - GGK(Biotin)
0.25 mg 64360-025 $115
[Lys(Me3)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me3), biotin - labeled
ARTKQTAR - K(Me3) - STGGKAPRKQLA - GGK(Biotin)
ARTKQTAR - K(Me3) - STGGKAPRKQLA - GGK(Biotin)
1 mg 64360-1 $313
[Lys(Me3)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me3), biotin - labeled, amide
ARTKQTAR - K(Me3) - STGGKAPRKQLAGG - K(Biotin) - NH2
ARTKQTAR - K(Me3) - STGGKAPRKQLAGG - K(Biotin) - NH2
0.25 mg 64628-025 $115
[Lys(Me3)9] - Histone H3 (1 - 21) - GGK(Biotin), H3K9(Me3), biotin - labeled, amide
ARTKQTAR - K(Me3) - STGGKAPRKQLAGG - K(Biotin) - NH2
ARTKQTAR - K(Me3) - STGGKAPRKQLAGG - K(Biotin) - NH2
1 mg 64628-1 $335
[pSer10] - Histone H3 (1 - 21) - GGK(Biotin); H3pS10, biotin - labeled
ARTKQTARK - pS - TGGKAPRKQLA - GGK(Biotin) - NH2
ARTKQTARK - pS - TGGKAPRKQLA - GGK(Biotin) - NH2
0.25 mg 64611-025 $143
[pSer10] - Histone H3 (1 - 21) - GGK(Biotin); H3pS10, biotin - labeled
ARTKQTARK - pS - TGGKAPRKQLA - GGK(Biotin) - NH2
ARTKQTARK - pS - TGGKAPRKQLA - GGK(Biotin) - NH2
1 mg 64611-1 $385
[pSer10), Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin), biotin - labeled
ARTKQTARK - pS - TGG - K(Ac) - APRKQLAGGK(Biotin)
ARTKQTARK - pS - TGG - K(Ac) - APRKQLAGGK(Biotin)
0.25 mg 64364-025 $115
[pSer10), Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin), biotin - labeled
ARTKQTARK - pS - TGG - K(Ac) - APRKQLAGGK(Biotin)
ARTKQTARK - pS - TGG - K(Ac) - APRKQLAGGK(Biotin)
1 mg 64364-1 $291
[pThr11] - Histone H3(1 - 21) - GGK(Biotin), H3pT11, biotin - labeled
ARTKQTARKS - pT - GGKAPRKQLAGG - K(Biotin) - NH2
ARTKQTARKS - pT - GGKAPRKQLAGG - K(Biotin) - NH2
0.25 mg 64973-025 $105
[pThr11] - Histone H3(1 - 21) - GGK(Biotin), H3pT11, biotin - labeled
ARTKQTARKS - pT - GGKAPRKQLAGG - K(Biotin) - NH2
ARTKQTARKS - pT - GGKAPRKQLAGG - K(Biotin) - NH2
1 mg 64973-1 $325
[Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin), H3K14(Ac), biotin - labeled
ARTKQTARKSTGG - K(Ac) - APRKQLA - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APRKQLA - GGK(Biotin)
0.25 mg 64362-025 $115
[Lys(Ac)14] - Histone H3 (1 - 21) - GGK(Biotin), H3K14(Ac), biotin - labeled
ARTKQTARKSTGG - K(Ac) - APRKQLA - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APRKQLA - GGK(Biotin)
1 mg 64362-1 $247
[Lys(Me1)14] - Histone H3(1 - 21) - GGK(Biotin), H3K14(Me1), biotin - labeled
ARTKQTARKSTGG - K(Me1) - APRKQLAGG - K(Biotin) - NH2
ARTKQTARKSTGG - K(Me1) - APRKQLAGG - K(Biotin) - NH2
0.25 mg 64974-025 $143
[Lys(Me1)14] - Histone H3(1 - 21) - GGK(Biotin), H3K14(Me1), biotin - labeled
ARTKQTARKSTGG - K(Me1) - APRKQLAGG - K(Biotin) - NH2
ARTKQTARKSTGG - K(Me1) - APRKQLAGG - K(Biotin) - NH2
1 mg 64974-1 $385
[Lys(Me2)14] - Histone H3(1 - 21) - GGK(Biotin), H3K14(Me2), biotin - labeled
ARTKQTARKSTGG - K(Me2) - APRKQLAGG - K(Biotin) - NH2
ARTKQTARKSTGG - K(Me2) - APRKQLAGG - K(Biotin) - NH2
0.25 mg 64971-025 $143
[Lys(Me2)14] - Histone H3(1 - 21) - GGK(Biotin), H3K14(Me2), biotin - labeled
ARTKQTARKSTGG - K(Me2) - APRKQLAGG - K(Biotin) - NH2
ARTKQTARKSTGG - K(Me2) - APRKQLAGG - K(Biotin) - NH2
1 mg 64971-1 $385
[Lys(Me3)14] - Histone H3 (1 - 21) - GGK(Biotin), H3K14(Me3), biotin - labeled
ARTKQTARKSTGG - K(Me3) - APRKQLAGG - K(Biotin) - NH2
ARTKQTARKSTGG - K(Me3) - APRKQLAGG - K(Biotin) - NH2
0.25 mg 64970-025 $115
[Lys(Me3)14] - Histone H3 (1 - 21) - GGK(Biotin), H3K14(Me3), biotin - labeled
ARTKQTARKSTGG - K(Me3) - APRKQLAGG - K(Biotin) - NH2
ARTKQTARKSTGG - K(Me3) - APRKQLAGG - K(Biotin) - NH2
1 mg 64970-1 $313
[Arg(Me1)17] - Histone H3 (1 - 21) - GGK(Biotin), H3R17(Me1), biotin - labeled
ARTKQTARKSTGGKAP - R(Me1) - KQLA - GGK(Biotin) - NH2
ARTKQTARKSTGGKAP - R(Me1) - KQLA - GGK(Biotin) - NH2
0.25 mg 64632-025 $143
[Arg(Me1)17] - Histone H3 (1 - 21) - GGK(Biotin), H3R17(Me1), biotin - labeled
ARTKQTARKSTGGKAP - R(Me1) - KQLA - GGK(Biotin) - NH2
ARTKQTARKSTGGKAP - R(Me1) - KQLA - GGK(Biotin) - NH2
1 mg 64632-1 $385
[Arg(Me2a)17] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2a), biotin - labeled
ARTKQTARKSTGGKAP - R(Me2a) - KQLA - GGK(Biotin) - NH2
ARTKQTARKSTGGKAP - R(Me2a) - KQLA - GGK(Biotin) - NH2
0.25 mg 64634-025 $143
[Arg(Me2a)17] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2a), biotin - labeled
ARTKQTARKSTGGKAP - R(Me2a) - KQLA - GGK(Biotin) - NH2
ARTKQTARKSTGGKAP - R(Me2a) - KQLA - GGK(Biotin) - NH2
1 mg 64634-1 $385
[Arg(Me2a)17, Lys(Ac)18] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2a)K14(Ac), biotin - labeled  NEW
ARTKQTARKSTGGKAP - R(me2a) - K(ac) - QLAGG - K(biotin
) - NH2
0.25 mg 65414-025 $145
[Arg(Me2a)17, Lys(Ac)18] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2a)K14(Ac), biotin - labeled  NEW
ARTKQTARKSTGGKAP - R(me2a) - K(ac) - QLAGG - K(biotin
) - NH2
1 mg 65414-1 $395
[Arg(Me2s)17] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2s), biotin - labeled
ARTKQTARKSTGGKAP - R(Me2s) - KQLA - GGK(Biotin) - NH2
ARTKQTARKSTGGKAP - R(Me2s) - KQLA - GGK(Biotin) - NH2
0.25 mg 64633-025 $143
[Arg(Me2s)17] - Histone H3 (1 - 21) - GGK(Biotin); H3R17(Me2s), biotin - labeled
ARTKQTARKSTGGKAP - R(Me2s) - KQLA - GGK(Biotin) - NH2
ARTKQTARKSTGGKAP - R(Me2s) - KQLA - GGK(Biotin) - NH2
1 mg 64633-1 $385
[Cit17] - Histone H3 (1 - 21) - GGK(Biotin)
ARTKQTARKSTGGKAP - Cit - KQLAGG - K(Biotin)
ARTKQTARKSTGGKAP - Cit - KQLAGG - K(Biotin)
1 mg 65233-1 $335
[Cit17] - Histone H3 (1 - 21) - GGK(Biotin)
ARTKQTARKSTGGKAP - Cit - KQLAGG - K(Biotin)
ARTKQTARKSTGGKAP - Cit - KQLAGG - K(Biotin)
0.25 mg 65233-025 $115
[Lys(Ac)18] - Histone 3 (1 - 21) - GGK(Biotin); H3K18(Ac), biotin - labeled
ARTKQTARKSTGGKAPR - K(Ac) - QLA - GGK(Biotin) - NH2
ARTKQTARKSTGGKAPR - K(Ac) - QLA - GGK(Biotin) - NH2
0.25 mg 64638-025 $115
[Lys(Ac)18] - Histone 3 (1 - 21) - GGK(Biotin); H3K18(Ac), biotin - labeled
ARTKQTARKSTGGKAPR - K(Ac) - QLA - GGK(Biotin) - NH2
ARTKQTARKSTGGKAPR - K(Ac) - QLA - GGK(Biotin) - NH2
1 mg 64638-1 $335
[Lys(Me1)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me1), biotin - labeled
ARTKQTARKSTGGKAPR - K(Me1) - QLA - GGK(Biotin) - NH2
ARTKQTARKSTGGKAPR - K(Me1) - QLA - GGK(Biotin) - NH2
0.25 mg 64621-025 $115
[Lys(Me1)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me1), biotin - labeled
ARTKQTARKSTGGKAPR - K(Me1) - QLA - GGK(Biotin) - NH2
ARTKQTARKSTGGKAPR - K(Me1) - QLA - GGK(Biotin) - NH2
1 mg 64621-1 $335
[Lys(Me2)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me2), biotin - labeled
ARTKQTARKSTGGKAPR - K(Me2) - QLA - GGK(Biotin) - NH2
ARTKQTARKSTGGKAPR - K(Me2) - QLA - GGK(Biotin) - NH2
0.25 mg 64620-025 $115
[Lys(Me2)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me2), biotin - labeled
ARTKQTARKSTGGKAPR - K(Me2) - QLA - GGK(Biotin) - NH2
ARTKQTARKSTGGKAPR - K(Me2) - QLA - GGK(Biotin) - NH2
1 mg 64620-1 $335
[Lys(Me3)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me3), biotin - labeled
ARTKQTARKSTGGKAPR - K(Me3) - QLAGG - K(Biotin) - NH2
ARTKQTARKSTGGKAPR - K(Me3) - QLAGG - K(Biotin) - NH2
0.25 mg 64622-025 $115
[Lys(Me3)18] - Histone H3 (1 - 21) - GGK(Biotin), H3K18(Me3), biotin - labeled
ARTKQTARKSTGGKAPR - K(Me3) - QLAGG - K(Biotin) - NH2
ARTKQTARKSTGGKAPR - K(Me3) - QLAGG - K(Biotin) - NH2
1 mg 64622-1 $335
[Lys(Ac)9] - Histone H3 (1 - 24), H3K9(Ac)
ARTKQTAR - K(Ac) - STGGKAPRKQLATKA
ARTKQTAR - K(Ac) - STGGKAPRKQLATKA
1 mg 64453 $181
[Lys(Me3)9] - Histone H3 (1 - 24), H3K9(Me3)
ARTKQTAR - K(Me3) - STGGKAPRKQLATKA
ARTKQTAR - K(Me3) - STGGKAPRKQLATKA
0.5 mg 63679 $181
[Lys(Ac)14/23] - Histone H3 (1 - 24) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APRKQLAT - K(Ac) - AGG - K(Biotin)
ARTKQTARKSTGG - K(Ac) - APRKQLAT - K(Ac) - AGG - K(Biot
in)
1 mg 65236-1 $385
[Lys(Ac)14/23] - Histone H3 (1 - 24) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APRKQLAT - K(Ac) - AGG - K(Biotin)
ARTKQTARKSTGG - K(Ac) - APRKQLAT - K(Ac) - AGG - K(Biot
in)
0.25 mg 65236-025 $132
[Lys(Ac)14/18/23] - Histone H3 (1 - 24) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AGG - K(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AGG -
K(Biotin)
1 mg 65235-1 $385
[Lys(Ac)14/18/23] - Histone H3 (1 - 24) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AGG - K(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AGG -
K(Biotin)
0.25 mg 65235-025 $132
Histone H3 (1 - 25), amide
ARTKQTARKSTGGKAPRKQLATKAA - NH2
ARTKQTARKSTGGKAPRKQLATKAA - NH2
1 mg 61703 $198
[Lys(Me3)4] - Histone H3 (1 - 25); H3K4(Me3)
ART - K(Me3) - QTARKSTGGKAPRKQLATKAA - NH2
ART - K(Me3) - QTARKSTGGKAPRKQLATKAA - NH2
1 mg 64636-1 $313
[Lys(Me3)4] - Histone H3 (1 - 25); H3K4(Me3)
ART - K(Me3) - QTARKSTGGKAPRKQLATKAA - NH2
ART - K(Me3) - QTARKSTGGKAPRKQLATKAA - NH2
0.25 mg 64636-025 $105
[Lys(Ac)14/18/23/27] - Histone H3 (1 - 30) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AAR - K(Ac) - SAPGG - K(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AAR -
K(Ac) - SAPGG - K(Biotin)
0.25 mg 65227-025 $132
[Lys(Ac)14/18/23/27] - Histone H3 (1 - 30) - GGK(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AAR - K(Ac) - SAPGG - K(Biotin)
ARTKQTARKSTGG - K(Ac) - APR - K(Ac) - QLAT - K(Ac) - AAR -
K(Ac) - SAPGG - K(Biotin)
1 mg 65227-1 $385
Histone H3(1 - 35)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
0.1 mg 65364-01 $180
Histone H3(1 - 35)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGV
0.25 mg 65364-025 $350
Histone H3 (1 - 50)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGT
VALRE
0.1 mg 65367-01 $280
Histone H3 (1 - 50)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGT
VALRE
0.25 mg 65367-025 $560
Histone H3 (1 - 50) - GGK(Biotin), biotin - labeled
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREGG - K(Biotin)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGT
VALREGG - K(Biotin)
0.25 mg 65366-025 $580
Histone H3 (1 - 50) - GGK(Biotin), biotin - labeled
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREGG - K(Biotin)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGT
VALREGG - K(Biotin)
0.1 mg 65366-01 $290
Histone H3 (1 - 55), biotin - labeled, acetylated
Ac - ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ - K(LC - Biotin) - NH2
Ac - ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYR
PGTVALREIRRYQ - K(LC - Biotin) - NH2
0.1 mg 65362-01 $300
Histone H3 (1 - 55), biotin - labeled, acetylated
Ac - ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQ - K(LC - Biotin) - NH2
Ac - ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYR
PGTVALREIRRYQ - K(LC - Biotin) - NH2
0.25 mg 65362-025 $600
[Lys(Me1)9] - Histone H3 (3 - 17), H3K9(Me1)
TKQTAR - K(Me1) - STGGKAPR
TKQTAR - K(Me1) - STGGKAPR
1 mg 64372-1 $176
[Lys(Me2)9] - Histone H3 (3 - 17), H3K9(Me2)
TKQTAR - K(Me2) - STGGKAPR
TKQTAR - K(Me2) - STGGKAPR
1 mg 64373-1 $176
[Lys(Me3)9] - Histone H3 (3 - 17), H3K9(Me3)
TKQTAR - K(Me3) - STGGKAPR
TKQTAR - K(Me3) - STGGKAPR
1 mg 64374-1 $176
Histone H3 (5 - 23)
QTARKSTGGKAPRKQLASK
QTARKSTGGKAPRKQLASK
1 mg 65135 $105
[Lys(Ac)14] - Histone H3 (9 - 19), H3K14(Ac)
KSTGG - K(Ac) - APRKQ
KSTGG - K(Ac) - APRKQ
1 mg 63681 $83
[Arg(Me1)26] - Histone H3 (15 - 36) - K(Biotin), H3R26(Me1), biotin labeled
APRKQLATKAA - R(Me1) - KSAPATGGVK - K(Biotin) - NH2
APRKQLATKAA - R(Me1) - KSAPATGGVK - K(Biotin) - NH2
0.25 mg 64608-025 $143
[Arg(Me1)26] - Histone H3 (15 - 36) - K(Biotin), H3R26(Me1), biotin labeled
APRKQLATKAA - R(Me1) - KSAPATGGVK - K(Biotin) - NH2
APRKQLATKAA - R(Me1) - KSAPATGGVK - K(Biotin) - NH2
1 mg 64608-1 $385
Histone H3 (15 - 36) - GGK(Biotin)  NEW
APRKQLATKAARKSAPATGGVKGG - K(biotin)
0.25 mg 65415-025 $115
Histone H3 (15 - 36) - GGK(Biotin)  NEW
APRKQLATKAARKSAPATGGVKGG - K(biotin)
1 mg 65415-1 $335
[Arg(Me2a)26] - Histone H3 (15 - 36) - GGK(Biotin), H3R26(Me2a), biotin labeled
APRKQLATKAA - R(Me2a) - KSAPATGGVKGG - K(Biotin)
APRKQLATKAA - R(Me2a) - KSAPATGGVKGG - K(Biotin)
0.25 mg 65261-025 $130
[Arg(Me2a)26] - Histone H3 (15 - 36) - GGK(Biotin), H3R26(Me2a), biotin labeled
APRKQLATKAA - R(Me2a) - KSAPATGGVKGG - K(Biotin)
APRKQLATKAA - R(Me2a) - KSAPATGGVKGG - K(Biotin)
1 mg 65261-1 $350
[Arg(Me2s)26] - Histone H3 (15 - 36) - GGK(Biotin), H3R26(Me2s), biotin labeled  NEW
APRKQLATKAA - R(me2s) - KSAPATGGVKGG - K(biotin)
0.25 mg 65416-025 $130
[Arg(Me2s)26] - Histone H3 (15 - 36) - GGK(Biotin), H3R26(Me2s), biotin labeled  NEW
APRKQLATKAA - R(me2s) - KSAPATGGVKGG - K(biotin)
1 mg 65416-1 $350
Histone H3 (15–39)
APRKQLATKAARKSAPATGGVKKPH
APRKQLATKAARKSAPATGGVKKPH
1 mg 61705 $220
[Lys(Me1)27] - Histone H3 (15 - 39) - K(Biotin), H3K27(Me1), biotin - labeled
APRKQLATKAAR - K(Me) - SAPATGGVKKPH - K(Biotin) - NH2
APRKQLATKAAR - K(Me) - SAPATGGVKKPH - K(Biotin) - NH2
0.25 mg 64540 $115
[Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Me2), biotin - labeled
ATKAARKSAPATGGV - K(Me2) - KPHRYRPG - GK(Biotin)
ATKAARKSAPATGGV - K(Me2) - KPHRYRPG - GK(Biotin)
0.25 mg 64442-025 $115
[Lys(Me2)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Me2), biotin - labeled
ATKAARKSAPATGGV - K(Me2) - KPHRYRPG - GK(Biotin)
ATKAARKSAPATGGV - K(Me2) - KPHRYRPG - GK(Biotin)
1 mg 64442-1 $335
[Lys(Me3)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Me3), biotin - labeled
ATKAARKSAPATGGV - K(Me3) - KPHRYRPG - GK(Biotin)
ATKAARKSAPATGGV - K(Me3) - KPHRYRPG - GK(Biotin)
0.25 mg 64441-025 $115
[Lys(Me3)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Me3), biotin - labeled
ATKAARKSAPATGGV - K(Me3) - KPHRYRPG - GK(Biotin)
ATKAARKSAPATGGV - K(Me3) - KPHRYRPG - GK(Biotin)
1 mg 64441-1 $335
Histone H3 (21 - 44)
ATKAARKSAPATGGVKKPHRYRPG
ATKAARKSAPATGGVKKPHRYRPG
1 mg 64454-1 $193
Histone H3 (21 - 44) - GK(Biotin), biotin - labeled
ATKAARKSAPATGGVKKPHRYRPG - GK(Biotin)
ATKAARKSAPATGGVKKPHRYRPG - GK(Biotin)
0.25 mg 64440-025 $115
Histone H3 (21 - 44) - GK(Biotin), biotin - labeled
ATKAARKSAPATGGVKKPHRYRPG - GK(Biotin)
ATKAARKSAPATGGVKKPHRYRPG - GK(Biotin)
1 mg 64440-1 $335
Histone H3 (21 - 44) - GK(Biotin), biotin - labeled, amide
ATKAARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
ATKAARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
1 mg 64641-1 $335
Histone H3 (21 - 44) - GK(Biotin), biotin - labeled, amide
ATKAARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
ATKAARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
0.25 mg 64641-025 $115
[Lys(Ac)27] - Histone 3 (21 - 44) - GK(Biotin); H3K27(Ac), biotin - labeled
ATKAAR - K(Ac) - SAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
ATKAAR - K(Ac) - SAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
1 mg 64637-1 $335
[Lys(Ac)27] - Histone 3 (21 - 44) - GK(Biotin); H3K27(Ac), biotin - labeled
ATKAAR - K(Ac) - SAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
ATKAAR - K(Ac) - SAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
0.25 mg 64637-025 $115
[Lys(Me1)23] - Histone H3 (21 - 44) - GK(Biotin); H3K23(Me1), biotin - labeled
AT - K(Me1) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
AT - K(Me1) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH
2
1 mg 64617-1 $335
[Lys(Me1)23] - Histone H3 (21 - 44) - GK(Biotin); H3K23(Me1), biotin - labeled
AT - K(Me1) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
AT - K(Me1) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH
2
0.25 mg 64617-025 $115
[Lys(Me3)23] - Histone H3 (21 - 44) - GK(Biotin); H3K23(Me3), biotin - labeled
AT - K(Me3) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
AT - K(Me3) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH
2
1 mg 64619-1 $335
[Lys(Me3)23] - Histone H3 (21 - 44) - GK(Biotin); H3K23(Me3), biotin - labeled
AT - K(Me3) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
AT - K(Me3) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH
2
0.25 mg 64619-025 $115
[Lys(Me2)23] - Histone H3 (21 - 44) - GK(Biotin), H3K23(Me2), biotin - labeled
AT - K(Me2) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH2
AT - K(Me2) - AARKSAPSTGGVKKPHRYRPG - GK(Biotin) - NH
2
1 mg 64618-1 $335
[Lys(Me2)23] - Histone H3 (21 - 44) - GK(Biotin), H3K23(Me2), biotin - labeled
AT - K(Me2) - AARKSAPSTGGVKKPHRYRPGG - K(Biotin) - NH2
AT - K(Me2) - AARKSAPSTGGVKKPHRYRPGG - K(Biotin) - NH
2
0.25 mg 64618-025 $115
[Lys(Ac)27] - Histone H3 (21 - 43) - GGK(Biotin), H3K27(Ac), biotin - labeled
ATKAAR - K(Ac) - SAPATGGVKKPHRYRPGG - K(Biotin)
ATKAAR - K(Ac) - SAPATGGVKKPHRYRPGG - K(Biotin)
1 mg 64846-1 $269
[Lys(Ac)27] - Histone H3 (21 - 43) - GGK(Biotin), H3K27(Ac), biotin - labeled
ATKAAR - K(Ac) - SAPATGGVKKPHRYRPGG - K(Biotin)
ATKAAR - K(Ac) - SAPATGGVKKPHRYRPGG - K(Biotin)
0.25 mg 64846-025 $127
[Lys(Me1)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1), biotin - labeled
ATKAAR - K(Me1) - SAPATGGVKKPHRYRPG - GK(Biotin)
ATKAAR - K(Me1) - SAPATGGVKKPHRYRPG - GK(Biotin)
0.25 mg 64365-025 $115
[Lys(Me1)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me1), biotin - labeled
ATKAAR - K(Me1) - SAPATGGVKKPHRYRPG - GK(Biotin)
ATKAAR - K(Me1) - SAPATGGVKKPHRYRPG - GK(Biotin)
1 mg 64365-1 $335
[Lys(Me2)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me2), biotin - labeled
ATKAAR - K(Me2) - SAPATGGVKKPHRYRPG - GK(Biotin)
ATKAAR - K(Me2) - SAPATGGVKKPHRYRPG - GK(Biotin)
0.25 mg 64366-025 $115
[Lys(Me2)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me2), biotin - labeled
ATKAAR - K(Me2) - SAPATGGVKKPHRYRPG - GK(Biotin)
ATKAAR - K(Me2) - SAPATGGVKKPHRYRPG - GK(Biotin)
1 mg 64366-1 $303
[Lys(Me3)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3), biotin - labeled
ATKAAR - K(Me3) - SAPATGGVKKPHRYRPG - GK(Biotin)
ATKAAR - K(Me3) - SAPATGGVKKPHRYRPG - GK(Biotin)
0.25 mg 64367-025 $115
[Lys(Me3)27] - Histone H3 (21 - 44) - GK(Biotin), H3K27(Me3), biotin - labeled
ATKAAR - K(Me3) - SAPATGGVKKPHRYRPG - GK(Biotin)
ATKAAR - K(Me3) - SAPATGGVKKPHRYRPG - GK(Biotin)
1 mg 64367-1 $335
[Lys(Ac)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Ac), biotin - labeled
ATKAARKSAPATGGV - K(Ac) - KPHRYRPGG - K(Biotin)
ATKAARKSAPATGGV - K(Ac) - KPHRYRPGG - K(Biotin)
1 mg 64936-1 $335
[Lys(Ac)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Ac), biotin - labeled
ATKAARKSAPATGGV - K(Ac) - KPHRYRPGG - K(Biotin)
ATKAARKSAPATGGV - K(Ac) - KPHRYRPGG - K(Biotin)
0.25 mg 64936-025 $115
[pSer28] - Histone H3 (21 - 44)
ATKAARK - pS - APSTGGVKKPHRYRPG
ATKAARK - pS - APSTGGVKKPHRYRPG
1 mg 65213-1 $297
[pSer28] - Histone H3 (21 - 44)
ATKAARK - pS - APSTGGVKKPHRYRPG
ATKAARK - pS - APSTGGVKKPHRYRPG
0.25 mg 65213-025 $99
[pSer28] - Histone H3 (21 - 44) - GK (Biotin), biotin - labeled
ATKAARK - pS - APATGGVKKPHRYRPGG - K(Biotin)
ATKAARK - pS - APATGGVKKPHRYRPGG - K(Biotin)
0.25 mg 65369-025 $105
[pSer28] - Histone H3 (21 - 44) - GK (Biotin), biotin - labeled
ATKAARK - pS - APATGGVKKPHRYRPGG - K(Biotin)
ATKAARK - pS - APATGGVKKPHRYRPGG - K(Biotin)
1 mg 65369-1 $305
[Cit26] - Histone H3 (21 - 44) - GGK(Biotin)
ATKAA - Cit - KSAPATGGVKKPHRYRPGGG - K(Biotin)
ATKAA - Cit - KSAPATGGVKKPHRYRPGGG - K(Biotin)
1 mg 65234-1 $335
[Cit26] - Histone H3 (21 - 44) - GGK(Biotin)
ATKAA - Cit - KSAPATGGVKKPHRYRPGGG - K(Biotin)
ATKAA - Cit - KSAPATGGVKKPHRYRPGGG - K(Biotin)
0.25 mg 65234-025 $115
[Lys(Ac)23] - Histone H3 (21 - 44) - GK(Biotin); H3K23(Ac), biotin - labeled
AT - K(Ac) - AARKSAPATGGVKKPHRYRPGG - K(Biotin)
AT - K(Ac) - AARKSAPATGGVKKPHRYRPGG - K(Biotin)
1 mg 65241-1 $335
[Lys(Ac)23] - Histone H3 (21 - 44) - GK(Biotin); H3K23(Ac), biotin - labeled
AT - K(Ac) - AARKSAPATGGVKKPHRYRPGG - K(Biotin)
AT - K(Ac) - AARKSAPATGGVKKPHRYRPGG - K(Biotin)
0.25 mg 65241-025 $115
[Lys(Ac)23] - Histone H3 (21 - 44)
AT - K(Ac) - AARKSAPSTGGVKKPHRYRPG
AT - K(Ac) - AARKSAPSTGGVKKPHRYRPG
1 mg 65206-1 $297
[Lys(Ac)23] - Histone H3 (21 - 44)
AT - K(Ac) - AARKSAPSTGGVKKPHRYRPG
AT - K(Ac) - AARKSAPSTGGVKKPHRYRPG
0.25 mg 65206-025 $99
[Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Me1), biotin - labeled
ATKAARKSAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin)
ATKAARKSAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin)
0.25 mg 64368-025 $115
[Lys(Me1)36] - Histone H3 (21 - 44) - GK(Biotin), H3K36(Me1), biotin - labeled
ATKAARKSAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin)
ATKAARKSAPATGGV - K(Me1) - KPHRYRPG - GK(Biotin)
1 mg 64368-1 $335
[Lys(Me3)27] - Histone H3 (21 - 44), biotin - labeled
ATKAAR - K(Me3) - SAPATGGVKKPHRYRPG - K(Biotin)
ATKAAR - K(Me3) - SAPATGGVKKPHRYRPG - K(Biotin)
1 mg 65347-1 $305
[Lys(Me3)27] - Histone H3 (21 - 44), biotin - labeled
ATKAAR - K(Me3) - SAPATGGVKKPHRYRPG - K(Biotin)
ATKAAR - K(Me3) - SAPATGGVKKPHRYRPG - K(Biotin)
0.25 mg 65347-025 $105
Histone H3 (23 - 31)
KAARKSAPA
KAARKSAPA
1 mg 65384 $80
Histone H3 (23 - 34)
KAARKSAPATGG
KAARKSAPATGG
1 mg 64375-1 $99
Histone H3 (23 - 34) - Cys
KAARKSAPATGGC
KAARKSAPATGGC
1 mg 64398 $93
[Lys(Ac)27] - Histone H3 (23 - 34), H3K27(Ac)
KAAR - K(Ac) - SAPATGG
KAAR - K(Ac) - SAPATGG
1 mg 65387 $75
[Lys(Me1)27] - Histone H3 (23 - 34), H3K27(Me1)
KAAR - K(Me1) - SAPATGG
KAAR - K(Me1) - SAPATGG
1 mg 64376-1 $176
[Lys(Me2)27] - Histone H3 (23 - 34), H3K27(Me2)
KAAR - K(Me2) - SAPATGG
KAAR - K(Me2) - SAPATGG
1 mg 64377-1 $176
[Lys(Me3)27] - Histone H3 (23 - 34), H3K27(Me3)
KAAR - K(Me3) - SAPATGG
KAAR - K(Me3) - SAPATGG
1 mg 64378-1 $176
[Lys(Me3)27 - Histone H3 (23 - 34) - GGK(Biotin)
KAAR - K(Me3) - SAPATGGGG - K(Biotin)
KAAR - K(Me3) - SAPATGGGG - K(Biotin)
1 mg 65397 $210
[Lys(Me1)36] - Histone H3 (26 - 46) - K(Biotin), H3K36(Me1)
RKAAPATGGV - K(Me1) - KPHRYRPGTV - K(BIOTIN)
RKAAPATGGV - K(Me1) - KPHRYRPGTV - K(BIOTIN)
1 mg 64602-1 $335
[Lys(Me1)36] - Histone H3 (26 - 46) - K(Biotin), H3K36(Me1)
RKAAPATGGV - K(Me1) - KPHRYRPGTV - K(BIOTIN)
RKAAPATGGV - K(Me1) - KPHRYRPGTV - K(BIOTIN)
0.25 mg 64602-025 $115
[Lys(Me3)36] - Histone H3 (26 - 46) - K(Biotin), H3K36(Me3), biotin labeled
RKAAPATGGV - K(Me3) - KPHRYRPGTV - K(BIOTIN)
RKAAPATGGV - K(Me3) - KPHRYRPGTV - K(BIOTIN)
1 mg 64600-1 $335
[Lys(Me3)36] - Histone H3 (26 - 46) - K(Biotin), H3K36(Me3), biotin labeled
RKAAPATGGV - K(Me3) - KPHRYRPGTV - K(BIOTIN)
RKAAPATGGV - K(Me3) - KPHRYRPGTV - K(BIOTIN)
0.25 mg 64600-025 $115
[Lys(Me2)36] - Histone H3 (26 - 46), H3K36(Me2)
RKAAPATGGV - K(Me2) - KPHRYRPGTV - K(BIOTIN)
RKAAPATGGV - K(Me2) - KPHRYRPGTV - K(BIOTIN)
1 mg 64601-1 $335
[Lys(Me2)36] - Histone H3 (26 - 46), H3K36(Me2)
RKAAPATGGV - K(Me2) - KPHRYRPGTV - K(BIOTIN)
RKAAPATGGV - K(Me2) - KPHRYRPGTV - K(BIOTIN)
0.25 mg 64601-025 $115
[Lys(Me1)36] - Histone H3 (31 - 41), H3K36(Me1)
STGGV - K(Me1) - KPHRY
STGGV - K(Me1) - KPHRY
1 mg 64379-1 $176
[Lys(Me2)36] - Histone H3 (31 - 41), H3K36(Me2)
STGGV - K(Me2) - KPHRY
STGGV - K(Me2) - KPHRY
1 mg 64380-1 $176
[Lys(Me3)36] - Histone H3 (31 - 41), H3K36(Me3)
STGGV - K(Me3) - KPHRY
STGGV - K(Me3) - KPHRY
1 mg 64381-1 $176
[Lys(Ac)56] - Histone H3 (44 - 63)
GTVALREIRRYQ - K(Ac) - STELLIR
GTVALREIRRYQ - K(Ac) - STELLIR
1 mg 65204-1 $210
[Lys(Ac)56] - Histone H3 (44 - 63)
GTVALREIRRYQ - K(Ac) - STELLIR
GTVALREIRRYQ - K(Ac) - STELLIR
0.25 mg 65204-025 $70
Histone H3 (44 - 63) - GGK(Biotin), biotin - labeled
GTVALREIRRYQKSTELLIR - GGK(Biotin) - NH2
GTVALREIRRYQKSTELLIR - GGK(Biotin) - NH2
1 mg 64642-1 $335
Histone H3 (44 - 63) - GGK(Biotin), biotin - labeled
GTVALREIRRYQKSTELLIR - GGK(Biotin) - NH2
GTVALREIRRYQKSTELLIR - GGK(Biotin) - NH2
0.25 mg 64642-025 $115
[Lys(Me1)79] - Histone H3 (58 - 89)
TELLIRKLPFQRLVREIAQDF - K(Me1) - TDLRFQSAAI
TELLIRKLPFQRLVREIAQDF - K(Me1) - TDLRFQSAAI
1 mg 65223-1 $385
[Lys(Me1)79] - Histone H3 (58 - 89)
TELLIRKLPFQRLVREIAQDF - K(Me1) - TDLRFQSAAI
TELLIRKLPFQRLVREIAQDF - K(Me1) - TDLRFQSAAI
0.25 mg 65223-025 $132
[Lys(Me1)79] - Histone H3 (58 - 89) - GGK(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me1) - TDLRFQSAAIGG - K(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me1) - TDLRFQSAAIGG - K(B
iotin)
0.25 mg 65224-025 $149
[Lys(Me1)79] - Histone H3 (58 - 89) - GGK(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me1) - TDLRFQSAAIGG - K(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me1) - TDLRFQSAAIGG - K(B
iotin)
1 mg 65224-1 $435
[Lys(Me2)79] - Histone H3 (58 - 89) - GGK(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me2) - TDLRFQSAAIGG - K(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me2) - TDLRFQSAAIGG - K(B
iotin)
0.25 mg 65228-025 $149
[Lys(Me2)79] - Histone H3 (58 - 89) - GGK(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me2) - TDLRFQSAAIGG - K(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me2) - TDLRFQSAAIGG - K(B
iotin)
1 mg 65228-1 $435
[Lys(Me3)79] - Histone H3 (58 - 89) - GGK(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me3) - TDLRFQSAAIGG - K(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me3) - TDLRFQSAAIGG - K(B
iotin)
1 mg 65250-1 $495
[Lys(Me3)79] - Histone H3 (58 - 89) - GGK(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me3) - TDLRFQSAAIGG - K(Biotin)
TELLIRKLPFQRLVREIAQDF - K(Me3) - TDLRFQSAAIGG - K(B
iotin)
0.25 mg 65250-025 $165
Histone H3 (69 - 89), H3K79, amide  NEW
RLVREIAQDFKTDLRFQSSAV - NH2
1 mg 65425 $176
Histone H3 (69 - 89) - K(Biotin)
RLVREIAQDFKTDLRFQSSAV - K(Biotin)
RLVREIAQDFKTDLRFQSSAV - K(Biotin)
0.25 mg 65297-025 $83
Histone H3 (69 - 89) - K(Biotin)
RLVREIAQDFKTDLRFQSSAV - K(Biotin)
RLVREIAQDFKTDLRFQSSAV - K(Biotin)
1 mg 65297-1 $225
[Lys(Me2)79] - Histone H3 (69 - 89) - K(Biotin), H3K79(Me2), biotin - labeled
RLVREIAQDF - K(Me2) - TDLRFQSSAV - K(Biotin)
RLVREIAQDF - K(Me2) - TDLRFQSSAV - K(Biotin)
0.25 mg 64544 $127
[Lys(Me1)79] - Histone H3 (69 - 89), H3K79(Me1), amide  NEW
RLVREIAQDF - K(Me1) - TDLRFQSSAV - NH2
0.25 mg 65426-025 $115
[Lys(Me1)79] - Histone H3 (69 - 89), H3K79(Me1), amide  NEW
RLVREIAQDF - K(Me1) - TDLRFQSSAV - NH2
1 mg 65426-1 $297
[Lys(Me1)79] - Histone H3 (69 - 89) - K(Biotin), H3K79(Me1), biotin labeled
RLVREIAQDF - K(Me1) - TDLRFQSSAV - K(Biotin)
RLVREIAQDF - K(Me1) - TDLRFQSSAV - K(Biotin)
0.25 mg 64543 $127
[Lys(Me2)79] - Histone H3 (69 - 89), H3K79(Me2), amide  NEW
RLVREIAQDF - K(Me2) - TDLRFQSSAV - NH2
0.25 mg 65427-025 $115
[Lys(Me2)79] - Histone H3 (69 - 89), H3K79(Me2), amide  NEW
RLVREIAQDF - K(Me2) - TDLRFQSSAV - NH2
1 mg 65427-1 $297
[Lys(Me3)79] - Histone H3 (69 - 89), H3K79(Me3), amide  NEW
RLVREIAQDF - K(Me3) - TDLRFQSSAV - NH2
0.25 mg 65428-025 $115
[Lys(Me3)79] - Histone H3 (69 - 89), H3K79(Me3), amide  NEW
RLVREIAQDF - K(Me3) - TDLRFQSSAV - NH2
1 mg 65428-1 $297
[Lys(Me3)79] - Histone H3 (69 - 89) - K(Biotin), H3K79(Me3), biotin labeled
RLVREIAQDF - K(Me3) - TDLRFQSSAV - K(biotin)
RLVREIAQDF - K(Me3) - TDLRFQSSAV - K(biotin)
0.25 mg 64545-025 $127
[Lys(Me3)79] - Histone H3 (69 - 89) - K(Biotin), H3K79(Me3), biotin labeled
RLVREIAQDF - K(Me3) - TDLRFQSSAV - K(biotin)
RLVREIAQDF - K(Me3) - TDLRFQSSAV - K(biotin)
0.25 mg 64545-025 $127
[Lys(Me3)79,pThr80] - Histone H3 (69 - 89) - K(Biotin)
RLVREIAQDF - K(Me3) - pT - DLRFQSSAV - K(Biotin)
RLVREIAQDF - K(Me3) - pT - DLRFQSSAV - K(Biotin)
1 mg 65300-1 $395
[Lys(Me3)79,pThr80] - Histone H3 (69 - 89) - K(Biotin)
RLVREIAQDF - K(Me3) - pT - DLRFQSSAV - K(Biotin)
RLVREIAQDF - K(Me3) - pT - DLRFQSSAV - K(Biotin)
0.25 mg 65300-025 $140
Histone H3 (116–136), C116–136
KRVTIMPKDIQLARRIRGERA
KRVTIMPKDIQLARRIRGERA
1 mg 61704 $171
[Lys(Me1)9] - Histone H3 (1 - 21), H3K9(Me1)  NEW
ARTKQTAR - K(Me1) - STGGKAPRKQLA
ARTKQTAR - K(Me1) - STGGKAPRKQLA
1 mg 65398 $210
  < Back