Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptides - Mouse/Rat
 Product Size Catalog # US$  
Beta - Amyloid Peptide (1 - 42), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
0.5 mg AS-25381 $341
Beta - Amyloid Peptide (1 - 42), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
1 mg AS-25231 $545
Beta - Amyloid Peptide (1 - 40), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
0.5 mg AS-25380 $264
Beta - Amyloid Peptide (1 - 40), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
1 mg AS-25230 $423
Beta - Amyloid (1 - 40) - Lys(Biotin) - NH2, mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV - K(Biotin) - NH2
0.1 mg AS-63356 $165
Beta - Amyloid (1 - 38), mouse, rat
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGG
1 mg AS-62476 $423
  < Back