Peptides  >  Amyloid Peptides  >  Amyloid Precursor Protein (APP) / Amyloid Precursor-like Protein (APLP)
 Product Size Catalog # US$  
Beta - Amyloid A4 Protein Precursor (740 - 770), APP (C31)
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
1 mg AS-62073 $253
  < Back