Peptides  >  Amyloid Peptides  >  Amyloid Precursor Protein (APP) / Amyloid Precursor-like Protein (APLP)
 Product Size Catalog # US$  
Amyloid Precursor Protein (APP) (44 - 62)
HMNVQNGKWDSDPSGTKTC
HMNVQNGKWDSDPSGTKTC
1 mg 61983 $181
Amyloid Precursor Protein (APP) (667 - 676)
SEVKMDAEFR
SEVKMDAEFR
1 mg 62065 $61
Amyloid Precursor Protein, (APP) (667 - 676), FRET peptide
Mca - SEVKMDAEFR - Dap(Dnp) - NH2
Mca - SEVKMDAEFR - Dap(Dnp) - NH2
1 mg 62075 $253
Amyloid Precursor Protein, (APP) (721 - 770)
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFF
EQMQN
0.5 mg 63322 $357
Amyloid Precursor - Like Protein 1, APLP1 (594 - 610)
GGGSLIVLSLLLLRKKK
GGGSLIVLSLLLLRKKK
1 mg 62913 $110
Amyloid Precursor - Like Protein 2, APLP2 (706 - 721)
AIATVIVISLVMLRKR
AIATVIVISLVMLRKR
1 mg 62912 $99
Beta - Amyloid A4 Protein Precursor (740 - 770), APP (C31)
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
1 mg 62073 $253
Beta - Amyloid Protein Precursor (657 - 676)
HHGVVEVDAAVTPEERHLSK
HHGVVEVDAAVTPEERHLSK
0.5 mg 25378 $99
Beta - Amyloid Protein Precursor (657 - 676)
HHGVVEVDAAVTPEERHLSK
HHGVVEVDAAVTPEERHLSK
1 mg 25379 $159
Beta - Amyloid Protein Precursor 770 (135 - 155)
FLHQERMDVCETHLHWHTVAK
FLHQERMDVCETHLHWHTVAK
1 mg 60236-1 $176
Beta - Amyloid/A4 Protein Precursor (APP) (319 - 335)
AKERLEAKHRERMSQVM
AKERLEAKHRERMSQVM
0.5 mg 25374 $99
Beta - Amyloid/A4 Protein Precursor (APP) (319 - 335)
AKERLEAKHRERMSQVM
AKERLEAKHRERMSQVM
1 mg 25375 $159
Beta - Amyloid/A4 Protein Precursor (APP) (328 - 332)
RERMS
RERMS
0.5 mg 25376 $39
Beta - Amyloid/A4 Protein Precursor (APP) (328 - 332)
RERMS
RERMS
1 mg 25377 $61
Beta - Amyloid/A4 Protein Precursor (APP) (96 - 110)
Ac - NWCKRGRKQCKTHPH - NH2 (Disulfide bond: 3 - 10)
Ac - NWCKRGRKQCKTHPH - NH2 (Disulfide bond: 3 - 10)
0.5 mg 25372 $99
Beta - Amyloid/A4 Protein Precursor (APP) (96 - 110)
Ac - NWCKRGRKQCKTHPH - NH2 (Disulfide bond: 3 - 10)
Ac - NWCKRGRKQCKTHPH - NH2 (Disulfide bond: 3 - 10)
1 mg 25373 $159
Beta - Amyloid/A4 Protein Precursor 770 (394 - 410)
AKERLEAKHRERMSQWM
AKERLEAKHRERMSQWM
1 mg 60233-1 $105
  < Back