Biotin-Labeled Histone Peptides


AnaSpec, EGT Group offers a wide selection of GO® (catalog) Histone peptides that are biotin-labeled. Single or combinations of post-translational modified (PTM) amino acid-containing biotinylated histone peptide sequences have been used in applications such as pull-down assays.1-2 Generally speaking, peptides used in pull-down assays are 15-20 amino acids in length with the modified amino acid flanked by 6-8 residues.1

Our wide selection of PTM peptide sequences include lysines that are acetylated, mono-, di- or tri-methylated; mono, di (a/symmetric) methylated or deiminated (citrullinated) arginines or phosphorylated threonines or serines.

- Wide selection of GO® (catalog) biotin-labeled histone (H2A, H2B, H3 & H4) peptides.

- PTM peptide sequences include:

  • Acetylated or mono, di & tri-methylated lysines
  • Mono, di (a/symmetric) methylated or citrullinated arginines
  • Phosphorylated threonine
  • Phosphorylated serine

- Negative control peptides available

Listed below are biotinylated histone peptides from AnaSpec, EGT Group. Grey shaded boxes denote the native peptide without biotin. Blue shaded boxes are biotinylated peptides without PTM. PTM sequences are listed in numerical order. Where applicable, acetylated peptides are followed by methylated, and citrullinated sequences. A wide selection of non-biotinylated histone peptides is also available. To view the full listing, please click here. Email service@anaspec.com for inquiries about custom peptide synthesis service or submit a price quotation request online.

Figure 1. Histone H2A (1-22) sequence and the available PTM amino acids.

Table 1. Listing of Histone H2A, biotin-labeled peptides.

Product

Size

Catalog #

Histone H2A

Histone H2A (1-20)
SGRGKQGGKARAKAKTRSSR

1 mg

AS-63676

Histone H2A (1-20)-GGK(Biotin); biotin-labeled
SGRGKQGGKARAKAKTRSSR-GGK(Biotin)

1 mg

AS-64842-1

Histone H2A (1-22)-GK(Biotin)
SGRGKQGGKARAKAKSRSSRAG-GK(Biotin)-NH2

1 mg

AS-64639-1



Figure 2. Histone H2B (1-22) sequence and the available PTM amino acids.

Table 2. Listing of Histone H2B, biotin-labeled peptides.

Product

Size

Catalog #

Histone H2B (21-35) & (21-41)

Histone H2B (21 -41), biotin-labeled
AQKKDGKKRKRSRKESYSIYV-GGK(Biotin)

1 mg

AS-64385-1



Figure 3. Histone H3 (1-21) sequence and the available single or combination PTM amino acids. Listings of H3 sequences such as (21-44), (26-46), (58-89) and (69-89) can be found in Table 3.

Table 3. Listing of H3 biotin-labeled Peptides.

Product

Size

Catalog #

Histone H3 (1-21)

Histone H3 (1-21), N-Terminal
ARTKQTARKSTGGKAPRKQLA

1 mg

AS-61701

Histone H3 (1-21), biotin-labeled
ARTKQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2

1 mg

AS-61702

[Cit 2/8/17]-Histone H3 (1-21)-GGK(Biotin), amide
A-Cit-TKQTA-Cit-KSTGGKAP-Cit-KQLAGG-K(Biotin)-NH2

0.25 mg

AS-65404

[Lys(Ac)4]-Histone H3 (1-21)-GGK(Biotin)
ART-K(Ac)-QTARKSTGGKAPRKQLAGG-K(biotin)

1 mg

AS-65207-1

[Lys(Me1)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me1), biotin-labeled
ART-K(Me1)-QTARKSTGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

AS-64355-025

AS-64355-1

[Lys(Me2)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me2), biotin-labeled
ART-K(Me2)-QTARKSTGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

AS-64356-025

AS-64356-1

[Lys(Me3)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me3), biotin-labeled
ART-K(Me3)-QTARKSTGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

AS-64357-025

AS-64357-1

[Lys(Me3)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me3), biotin-labeled
ART-K(Me3 -QTARKSTGGKAPRKQLA-GGK(Biotin)-NH2

1 mg

AS-64192

[Arg(Me1)8]-Histone H3 (1-21)-K(biotin), H3R8(Me1), biotin-labeled
ARTKQTA-R(Me1)-KSTGGKAPRKQLA-K(Biotin)-NH2

1 mg

AS-64607-1

[Arg(Me2a)8]-Histone H3(1-21)-K(Biotin), H3R8(Me2a), biotin-labeled
ARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2

1 mg

AS-64972-1

[Arg(Me2s)8]-Histone H3 (1-21), biotin-labeled
ARTKQTA-R(Me2s)-KSTGGKAPRKQLA-K(Biotin)

1 mg

AS-65351-1

[Cit8]-Histone H3 (1-21)-GGK(Biotin)
ARTKQTA-Cit-KSTGGKAPRKQLAGG-K(Biotin)

1 mg

AS-65232-1

[Lys(Ac)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Ac), biotin-labeled
ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

AS-64361-025

AS-64361-1

[Lys(Ac)9]-Histone H3 (1-21)-NH2, H3K9(Ac), biotin-labeled, amide
ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)-NH2

1 mg

AS-64190

[Lys(Me1)9]-Histone H3 (1-21), biotin-labeled
ARTKQTAR-K(Me1)-STGGKAPRKQLA-K(Biotin)

1 mg

AS-65349-1

[Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me1), biotin-labeled
ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

AS-64358-025

AS-64358-1

[Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin); H3K9(Me1), biotin-labeled
ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)-NH2

1 mg

AS-64626-1

[Lys(Me2)9]-Histone H3 (1-21) - K(Biotin), H3K9(Me2), biotin-labeled
ARTKQTAR-K(Me2)-STGGKAPRKQLA-K(Biotin)

1 mg

AS-63678

[Lys(Me2)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me2), biotin-labeled
ARTKQTAR-K(Me2)-STGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

AS-64359-025

AS-64359-1

[Lys(Me2)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me2), biotin-labeled
ARTKQTAR-K(Me2)-STGGKAPRKQLA-GGK(Biotin)-NH2

1 mg

AS-64627-1

[Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), biotin-labeled
ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

AS-64360-025

AS-64360-1

[Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), biotin-labeled
ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin)-NH2

1 mg

AS-64628-1

[Lys(Ac)9/14]-Histone H3 (1-21)-GGK(Biotin), H3K9/14(Ac), biotin-labeled
ARTKQTAR-K(Ac)-STGG-K(Ac)-APRKQLA-GGK(Biotin)

0.25 mg

1 mg

AS-64363-025

AS-64363-1

[pSer10]-Histone H3 (1-21)-GGK(Biotin); H3pS10, biotin-labeled
ARTKQTARK-pS-TGGKAPRKQLA-GGK(Biotin)-NH2

1 mg

AS-64611-1

[pSer10), Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), biotin-labeled
ARTKQTARK-pS-TGG-K(Ac)-APRKQLAGGK(Biotin)

0.25 mg

AS-64364-025

[pThr11]-Histone H3(1-21)-GGK(Biotin), H3pT11, biotin-labeled
ARTKQTARKS-pT-GGKAPRKQLAGG-K(Biotin)-NH2

1 mg

AS-64973-1

[Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), H3K14(Ac), biotin-labeled
ARTKQTARKSTGG - K(Ac) - APRKQLA - GGK(Biotin)

0.25 mg

1 mg

AS-64362-025

AS-64362-1

[Arg(Me1)17]-Histone H3 (1-21)-GGK(Biotin), H3R17(Me1), biotin-labeled
ARTKQTARKSTGGKAP-R(Me1)-KQLA-GGK(Biotin)-NH2

1 mg

AS-64632-1

[Cit17]-Histone H3 (1-21)-GGK(Biotin)
ARTKQTARKSTGGKAP-Cit-KQLAGG-K(Biotin)

1 mg

AS-65233-1

[Lys(Ac)18]-Histone 3 (1-21)-GGK(Biotin); H3K18(Ac), biotin-labeled
ARTKQTARKSTGGKAPR-K(Ac)-QLA-GGK(Biotin)-NH2

1 mg

AS-64638-1

[Lys(Me1)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me1), biotin-labeled
ARTKQTARKSTGGKAPR-K(Me1)-QLA-GGK(Biotin)-NH2

1 mg

AS-64621-1

[Lys(Me2)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me2), biotin-labeled
ARTKQTARKSTGGKAPR-K(Me2)-QLA-GGK(Biotin)-NH2

1 mg

AS-64620-1

Histone H3 (1-24) & (1-30)

[Lys(Ac)14/18/23]-Histone H3 (1-24)-GGK(Biotin)
ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AGG-K(Biotin)

1 mg

AS-65235-1

[Lys(Ac)14/18/23/27]-Histone H3 (1-30)-GGK(Biotin)
ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAPGG-K(Biotin)

1 mg

AS-65227-1

Histone H3 (1-50) & (1-55)

Histone H3 (1-50)-GGK(Biotin), biotin-labeled
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREGG-K(Biotin)

0.25 mg

AS-65366-025

Histone H3 (15-36), (15-39) & (21-43)

[Arg(Me2a)26]-Histone H3 (15-36)-GGK(Biotin)
APRKQLATKAA-R(Me2a)-KSAPATGGVKGG-K(Biotin)

1 mg

AS-65261-1

[Lys(Ac)27]-Histone H3 (21-43)-GGK(Biotin), H3K27(Ac), biotin-labeled
ATKAAR-K(Ac)-SAPATGGVKKPHRYRPGG-K(Biotin)

1 mg

AS-64846-1

Histone H3 (21-44)

Histone H3 (21-44)
ATKAARKSAPATGGVKKPHRYRPG

1 mg

AS-64454-1

Histone H3 (21-44)-GK(Biotin), biotin-labeled
ATKAARKSAPATGGVKKPHRYRPG-GK(Biotin)

0.25 mg

1 mg

AS-64440-025

AS-64440-1

Histone H3 (21-44) - GK(Biotin), biotin-labeled, amide
ATKAARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2

1 mg

AS-64641-1

[Lys(Ac)23]-Histone H3 (21-44)-GK(Biotin); H3K23(Ac), biotin-labeled
AT-K(Ac)-AARKSAPATGGVKKPHRYRPGG-K(Biotin)

1 mg

AS-65241-1

[Lys(Me1)23]-Histone H3 (21-44)-GK(Biotin); H3K23(Me1), biotin-labeled
AT-K(Me1)-AARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2

1 mg

AS-64617-1

[Cit26]-Histone H3 (21-44)-GGK(Biotin)
ATKAA-Cit-KSAPATGGVKKPHRYRPGGG-K(Biotin)

1 mg

AS-65234-1

[Lys(Ac)27]-Histone 3 (21-44)-GK(Biotin); H3K27(Ac), biotin-labeled
ATKAAR-K(Ac)-SAPSTGGVKKPHRYRPG-GK(Biotin)-NH2

1 mg

AS-64637-1

[Lys(Me1)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me1), biotin-labeled
ATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin)

0.25 mg

1 mg

AS-64365-025

AS-64365-1

[Lys(Me2)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me2), biotin-labeled
ATKAAR-K(Me2)-SAPATGGVKKPHRYRPG-GK(Biotin)

0.25 mg

1 mg

AS-64366-025

AS-64366-1

[Lys(Me3)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me3), biotin-labeled
ATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-GK(Biotin)

0.25 mg

1 mg

AS-64367-025

AS-64367-1

[pSer28]-Histone H3 (21-44)-GK(Biotin), biotin-labeled
ATKAARK-pS-APATGGVKKPHRYRPG-GK(Biotin)

1 mg

AS-65369-1

[Lys(Ac)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Ac), biotin-labeled
ATKAARKSAPATGGV-K(Ac)-KPHRYRPG-GK(Biotin)

1 mg

AS-64936-1

[Lys(Me1)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me1), biotin-labeled
ATKAARKSAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)

0.25 mg

1 mg

AS-64368-025

AS-64376-1

[Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me2), biotin-labeled
ATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin)

0.25 mg

1 mg

AS-64442-025

AS-64442-1

[Lys(Me3)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me3), biotin-labeled
ATKAARKSAPATGGV-K(Me3)-KPHRYRPG-GK(Biotin)

0.25 mg

1 mg

AS-64441-025

AS-64441-1

Histone H3 (23-34) & (26-46)

Histone H3 (23-34)
KAARKSAPATGG

1 mg

AS-64375-1

[Lys(Me3)27-Histone H3 (23-34)-GGK(Biotin)
KAAR-K(Me3)-SAPATGG-GGK(Biotin)

1 mg

AS-65397

[Lys(Me1)36]-Histone H3 (26-46)-K(Biotin), H3K36(Me1)
RKAAPATGGV-K(Me1)-KPHRYRPGTV-K(BIOTIN)

1 mg

AS-64602-1

[Lys(Me2)36]-Histone H3 (26-46), H3K36(Me2)
RKAAPATGGV - K(Me2) - KPHRYRPGTV - K(BIOTIN)

1 mg

AS-64601-1

Histone H3 (69-89)

Histone H3 (69-89)-K(Biotin)
RLVREIAQDFKTDLRFQSSAV-K(Biotin)

1 mg

AS-65297-1

[Lys(Me1)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me1), biotin-labeled
RLVREIAQDF-K(Me1)-TDLRFQSSAV-K(Biotin)

0.25 mg

1 mg

AS-64543

[Lys(Me2)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me2), biotin-labeled
RLVREIAQDF-K(Me2)-TDLRFQSSAV-K(Biotin)

0.25 mg

AS-64544

[Lys(Me3)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me3), biotin-labeled
RLVREIAQDF-K(Me3)-TDLRFQSSAV-K(biotin)

0.25 mg

AS-64545-025



Figure 4. Histone H4 (1-21) sequence and the available single or combination PTM amino acids. Listings of H4 sequences such as (1-23) and (1-25) can be found in Table 4.

Table 4. Listing of H4 biotin-labeled Peptides.

Product

Size

Catalog #

Histone H4 (1-21)

Histone H4 (1-21)
SGRGKGGKGLGKGGAKRHRKV

1 mg

AS-62499

Histone H4 (1-21)-Lys(Biotin)
Ac-SGRGKGGKGLGKGGAKRHRKV-GGK(Biotin)

1 mg

AS-62555

[Arg(Me1)3]-Histone H4(1-21)-GGK(Biotin), H4R3(Me1), biotin-labeled
Ac-SG-R(Me1)-GKGGKGLGKGGAKRHRKV-GGK(Biotin)

1 mg

AS-64977-1

[Arg(Me2a)3]-Histone H4(1-21)-GGK(Biotin), H4R3(Me2a), biotin-labeled
Ac-SG-R(Me2a)-GKGGKGLGKGGAKRHRKV-GGK(Biotin)

1 mg

AS-64976-1

[Lys(Ac)5]-Histone H4 (1-21)-GGK(Biotin), H4K5(Ac), biotin-labeled
Ac-SGRG-K(Ac)-GGKGLGKGGAKRHRKVGG-K(Biotin)

1 mg

AS-64844-1

[Lys(Ac)5/8/12/16]-Histone H4 (1-21)-GGK(Biotin), H4K5/8/12/16(Ac), biotin- labeled
SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVGG-K(Biotin)

1 mg

AS-64989-1

[Lys(Ac)8]-Histone H4 (1-21)-GGK(Biotin), H4K8(Ac), biotin-labeled
Ac-SGRGKGG-K(Ac)-GLGKGGAKRHRKV-GGK(Biotin)

1 mg

AS-64843-1

[Lys(Ac)12]-Histone H4 (1-21)-GGK(Biotin), H4K12(Ac), biotin-labeled
Ac-SGRGKGGKGLG-K(Ac)-GGAKRHRKVGG-K(Biotin)

1 mg

AS-64849-1

[Lys(Me1)12]-Histone H4(1-21)-GGK(Biotin), H4K12(Me1), biotin-labeled
Ac - SGRGKGGKGLG-K(Me1)-GGAKRHRKVGG-K(Biotin)

1 mg

AS-64980-1

[Lys(Me3)12]-Histone H4(1-21)-GGK(Biotin), H4K12(Me3), biotin-labeled
Ac-SGRGKGGKGLG-K(Me3)-GGAKRHRKVGG-K(Biotin)

1 mg

AS-64979-1

[Lys(Ac)16]-Histone H4 (1-21)-GGK(Biotin), H4K16(Ac), biotin-labeled
Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKVGG-K(Biotin)

1 mg

AS-64847-1

Histone H4 (1-23)

Histone H4 (1-23)-GSGSK, C-terminal biotin-labeled
SGRGKGGKGLGKGGAKRHRKVLRGSGS-K(Biotin)

1 mg

AS-65002

Histone H4 (1-23)-GGK(Biotin), biotin labeled, amide
SGRGKGGKGLGKGGAKRHRKVLRGG-K(Biotin)-NH2

1 mg

AS-65097

[Arg(Me1)3]-Histone H4 (1-23)-GGK(Biotin)
SG-R(Me1)-GKGGKGLGKGGAKRHRKVLRGG-K(Biotin)

1 mg

AS-65277-1

[Arg(Me2s)3]-Histone H4 (1-23)-GGK(Biotin)
SG-R(Me2s)-GKGGKGLGKGGAKRHRKVLRGG-K(Biotin)

1 mg

AS-65276-1

[Arg(Me2a)3]-Histone H4 (1-23)-GGK(Biotin)
SG - R(Me2a) - GKGGKGLGKGGAKRHRKVLRGG - K(Biotin)

1 mg

AS-65278-1

[Cit3]-Histone H4 (1 -23)-GGK(Biotin)
SG - Cit - GKGGKGLGKGGAKRHRKVLRGG - K(Biotin)

1 mg

AS-65275-1

[Lys(Me1)20]-Histone H4 (1-23)-GGK(Biotin), H3K20(Me1), biotin-labeled
SGRGKGGKGLGKGGAKRHR-K(Me1)-VLR-GGK(Biotin)-NH2

1 mg

AS-64623-1

[Lys(Me2)20]-Histone H4 (1-23)-GGK(Biotin), H3K20(Me2), biotin-labeled
SGRGKGGKGLGKGGAKRHR-K(Me2)-VLR-GGK(Biotin)-NH2

1 mg

AS-64624-1

[Lys(Me3)20]-Histone H4 (1-23)-GGK(Biotin), H3K20(Me3), biotin-labeled
SGRGKGGKGLGKGGAKRHR-K(Me3)-VLR-GGK(Biotin)-NH2

1 mg

AS-64625-1

Histone H4 (1-25)

Histone H4 (1-25)-GSGSK(Biotin)
SGRGKGGKGLGKGGAKRHRKVLRDNGSGS-K(Biotin)

1 mg

AS-65242-1

[Lys(Ac)5]-Histone H4 (1-25)-GSGSK(Biotin); H4K5(Ac), biotin-labeled
SGRG-K(Ac)-GGKGLGKGGAKRHRKVLRDNGSGS-K(Biotin)

1 mg

AS-65229-1

[Lys(Ac)8]-Histone H4 (1-25)-GSGSK(Biotin); H4K8(Ac), biotin-labeled
SGRGKGG-K(Ac)-GLGKGGAKRHRKVLRDNGSGS-K(Biotin)

1 mg

AS-65230-1

[Lys(Ac)5/8/12/16]-Histone H4 (1-25)-GSGSK(Biotin)
SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGS-K(Biotin)

1 mg

AS-65248-1

[Lys(Ac)12]-Histone H4 (1-25)-GSGSK(Biotin); H4K12(Ac), biotin-labeled
SGRGKGGKGLG-K(Ac)-GGAKRHRKVLRDNGSGS-K(Biotin)

1 mg

AS-65208-1

[Lys(Ac)12/16]-Histone H4(1-25)-GSGSK(Biotin); H4K12/16(Ac), biotin-labeled
SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGS-K(Biotin)

1 mg

AS-65222-1

[Lys(Ac)16]-Histone H4 (1-25)-GSGSK(Biotin); H4K16(Ac), biotin-labeled
SGRGKGGKGLGKGGA-K(Ac)-RHRKVLRDNGSGS-K(Biotin)

1 mg

AS-65209-1

[Lys(Ac)12/16, Lys(Me3)20]-Histone H4 (1-25)-GSGSK(Biotin)
SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHR-K(Me3)-VLRDNGSGS-K(Biotin)

1 mg

AS-65226-1

[Lys(Ac)20]-Histone H4 (1-25)-GSGSK(Biotin); H4K20(Ac), biotin-labeled
SGRGKGGKGLGKGGAKRHR-K(Ac)-VLRDNGSGS-K(Biotin)

1 mg

AS-65212-1

Related Products:

Histone H1 Peptides - Full Listing

Histone H2A Peptides - Full Listing

Histone H2B Peptides - Full Listing

Histone H3 Peptides – Full Listing

Histone H4 Peptides - Full Listing

Histone Related Substrates – Full Listing
SensoLyte® 520 HDAC Assay Kit
SensoLyte® 520 Deubiquitination Assay Kit
SensoLyte® 440 Deubiquitination Assay Kit
SensoLyte® 520 FRET SIRT1 Assay Kit
SensoLyte® Green SIRT1 Assay Kit
SensoLyte® 520 FRET SIRT2 Assay Kit
SensoLyte® Green SIRT2 Assay Kit
SensoLyte® HAT (p300) Assay Kit
Monoclonal Antibody against 5-Methylcytidine

References:

1. Protocol Online http://www.protocol-online.org/cgi-bin/prot/view_cache.cgi?ID=4089.

2. Wysocka, J. Methods 40, 339 (2006).