Biotin-Labeled Histone Peptides


AnaSpec, EGT Group offers a wide selection of GO® (catalog) Histone peptides that are biotin-labeled. Single or combinations of post-translational modified (PTM) amino acid-containing biotinylated histone peptide sequences have been used in applications such as pull-down assays.1-2 Generally speaking, peptides used in pull-down assays are 15-20 amino acids in length with the modified amino acid flanked by 6-8 residues.1

Our wide selection of PTM peptide sequences include lysines that are acetylated, mono-, di- or tri-methylated; mono, di (a/symmetric) methylated or deiminated (citrullinated) arginines or phosphorylated threonines or serines.

- Wide selection of GO® (catalog) biotin-labeled histone (H2A, H2B, H3 & H4) peptides.

- PTM peptide sequences include:

  • Acetylated or mono, di & tri-methylated lysines
  • Mono, di (a/symmetric) methylated or citrullinated arginines
  • Phosphorylated threonine
  • Phosphorylated serine

- Negative control peptides available

AnaSpec, EGT Group is pleased to offer Mix and Match quantity discount of histone peptides on the same purchase order for April and May, 2012. This offer cannot be combined with other discounts. For US and Canadian customers only. Please mention promotional code, “HPM&M.”

2-5 units 5% off discount

6-10 units 10% off discount

11-19 units 15% off discount

≥20 units 20% off discount

Listed below are biotinylated histone peptides from AnaSpec, EGT Group. Grey shaded boxes denote the native peptide without biotin. Blue shaded boxes are biotinylated peptides without PTM. PTM sequences are listed in numerical order. Where applicable, acetylated peptides are followed by methylated, and citrullinated sequences. A wide selection of non-biotinylated histone peptides is also available. To view the full listing, please click here. Email service@anaspec.com for inquiries about custom peptide synthesis service or submit a price quotation request online.

Figure 1. Histone H2A (1-22) sequence and the available PTM amino acids.

Table 1. Listing of Histone H2A, biotin-labeled peptides.

Product

Size

Catalog #

[Lys(Biotin)9]-Histone H2A (1-12)-Cys
SGRGKQGG-K(Biotin)-ARAC

1 mg

63675

Histone H2A (1-20)
SGRGKQGGKARAKAKTRSSR

1 mg

63676

Histone H2 (1-20)–WGK(Biotin) labeled
SGRGKQGGKARAKAKTRSSR-WGK(Biotin)

0.25 mg

1 mg

65049-025

65049-1

Histone H2A (1-20)-GGK(Biotin); biotin-labeled
SGRGKQGGKARAKAKTRSSR-GGK(Biotin)

0.25 mg

1 mg

64842-025

64842-1

[Lys(Ac)5]-Histone H2A (1-20)-GGK(Biotin), H2AK5(Ac), biotin-labeled
SGRG-K(Ac)–QGGKARAKAKTRSSR-GGK(Biotin)

0.25 mg

1 mg

64845-025

64845-1

Histone H2A (1-22)-GK(Biotin)
SGRGKQGGKARAKAKSRSSRAG-GK(Biotin)-NH2

0.25 mg

1 mg

64639-025

64639-1

[pSer1] - Histone H2A (1-22)-GGK(Biotin)
pS – GRGKQGGKARAKAKSRSSRAG-GGK(Biotin)

0.25 mg

1 mg

65274-025

65274-1

[Cit3]-Histone H2A (1-22)-GGK(Biotin)

SG-Cit–GKQGGKARAKAKSRSSRAG-GGK(Biotin)

0.25 mg

1 mg

65273-025

65273-1

[Lys(Ac)5]-Histone H2A (1-22)-GK(Biotin)-NH2; H2AK5(Ac), biotin-labeled, amide
SGRG-K(Ac)-QGGKARAKAKSRSSRAG-GK(Biotin)-NH2

0.25 mg

1 mg

64644-025

64644-1

[Lys(Ac)13]-Histone H2A (1-22)-GK(Biotin)-NH2; H2AK13(Ac), biotin-labeled
SGRGKQGGKARA-K(Ac)-AKSRSSRAG-GK(Biotin)-NH2

0.25 mg

1 mg

64645-025

64645-1



Figure 2. Histone H2B (1-22) sequence and the available PTM amino acids.

Table 2. Listing of Histone H2B, biotin-labeled peptides.

Product

Size

Catalog #

Histone H2B (1-21)

Histone H2B (1-21), biotin-labeled
PEPSKSAPAPKKGSKKAITKA-GGK(Biotin)

0.25 mg

1 mg

64386-025

64386-1

[Lys(Ac)11]-Histone H2B (1-21)-GGK(Biotin), H2BK11(Ac), biotin-labeled
PEPSKSAPAP-K(Ac)-KGSKKAITKA-GGK(Biotin)

0.25 mg

1 mg

64850-025

64850-1

[Lys(Ac)15]-Histone H2B (1-21)-GGK(Biotin), H2BK15(Ac), biotin-labeled
PEPSKSAPAPKKGS-K(Ac)-KAITKA-GGK(Biotin)

0.25 mg

1 mg

64848-025

64848-1

[Lys(Ac)15]-Histone H2B (1-21)-WGK(Biotin)
PEPSKSAPAPKKGS-K(Ac)-KAITKA-WGK(Biotin)

0.25 mg

1 mg

65331-025

65331-1

Histone H2B (1-22)-GGK(Biotin); biotin-labeled
PEPAKSAPAPKKGSKKAVTKAQ-GGK(Biotin)-NH2

0.25 mg

1 mg

64640-025

64640-1

[Lys(Ac)5]-Histone H2B (1-22)-GGK(Biotin)-NH2; H2BK5(Ac), biotin-labeled
PEPA-K(Ac)-SAPAPKKGSKKAVTKAQ-GGK(Biotin)-NH2

0.25 mg

1 mg

64646-025

64646-1

[Lys(Ac)12]-Histone H2B (1-22)-GGK(Biotin)-NH2; H2BK12(Ac), biotin-labeled
PEPAKSAPAPK-K(Ac)-GSKKAVTKAQ-GGK(Biotin)-NH2

0.25 mg

1 mg

64649-025

64649-1

[Lys(Ac)15]-Histone H2B (1-22)-GGK(Biotin)-NH2; H2BK15(Ac), biotin-labeled
PEPAKSAPAPKKGS-K(Ac)-KAVTKAQ-GGK(Biotin)-NH2

0.25 mg

1 mg

64647-025

64647-1

[Lys(Ac)20]-Histone H2B (1-22)-GGK(Biotin)-NH2; H2BK20(Ac), biotin-labeled
PEPAKSAPAPKKGSKKAVT-K(Ac)-AQ-GGK(Biotin)-NH2

0.25 mg

1 mg

64648-025

64648-1

[Lys(Me1)5]-Histone H2B (1-22)-GGK(Biotin), H2BK5(Me1), biotin-labeled
PEPA-K(Me1)-SAPAPKKGSKKAVTKAQ-GGK(Biotin)-NH2

0.25 mg

1 mg

64614-025

64614-1

[Lys(Me2)5]-Histone H2B (1-22)-GGK(Biotin), H2BK5(Me2), biotin-labeled
PEPA-K(Me2)-SAPAPKKGSKKAVTKAQ-GGK(Biotin)-NH2

0.25 mg

1 mg

64616-025

64616-1

[Lys(Me3)5]-Histone H2B (1-22)-GGK(Biotin), H2BK5(Me3), biotin-labeled
PEPA-K(Me3)-SAPAPKKGSKKAVTKAQ-GGK(Biotin)-NH2

0.25 mg

1 mg

64615-025

64615-1

[pSer14]-Histone H2B (1-22)-GGK(Biotin)
PEPAKSAPAPKKG-pS-KKAVTKAQ-GGK(Biotin)

0.25 mg

1 mg

65258-025

65258-1

Histone H2B (21-35) & (21-41)

Histone H2B (21-35)
AQKKDGKKRKRSRKE

1 mg

64832

Histone H2B (21 -41), biotin-labeled
AQKKDGKKRKRSRKESYSIYV-GGK(Biotin)

0.25 mg

1 mg

64385-025

64385-1

[pSer32]-Histone H2B (21-41)-GGK(Biotin), biotin-labeled
AQKKDGKKRKR-pS-RKESYSIYV-GGK(Biotin)

0.25 mg

1 mg

65259-025

65259-1

[pSer36]-Histone H2B (21-41)-GGK(Biotin), biotin-labeled
AQKKDGKKRKRSRKE-pS-YSIYV-GGK(Biotin)-NH2

0.25 mg

1 mg

64577-025

64577-1



Figure 3. Histone H3 (1-21) sequence and the available single or combination PTM amino acids. Listings of H3 sequences such as (21-44), (26-46), (58-89) and (69-89) can be found in Table 3.

Table 3. Listing of H3 biotin-labeled Peptides.

Product

Size

Catalog #

Histone H3 (1-21)

Histone H3 (1-21), N-Terminal
ARTKQTARKSTGGKAPRKQLA

1 mg

61701

Histone H3 (1-21), biotin-labeled
ARTKQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2

1 mg

61702

[Arg(Me1)2]-Histone H3 (1-21)-GGK(Biotin), H3R2(Me1), biotin-labeled
A-R(Me1)-TKQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64629-025

64629-1

[Arg(Me2s)2]-Histone H3 (1-21)-GGK(Biotin); H3R2(Me2s), biotin-labeled
A-R(Me2s)-TKQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64631-025

64631-1

[Arg(Me2a)2]-Histone H3 (1-21)-GGK(Biotin), H3R2(Me2a), biotin-labeled
A-R(Me2a)-TKQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64630-025

64630-1

[Arg(Me2a)2, pThr3]-Histone H3 (1-21)-GGK(Biotin)
A-R(Me2a)-pT-KQTARKSTGGKAPRKQLAGG-K(Biotin)

0.25 mg

1 mg

65266-025

65266-1

[Arg(Me2s)2, pThr3]-Histone H3 (1-21)-GGK(Biotin)
A-R(Me2s)-pT-KQTARKSTGGKAPRKQLAGG-K(Biotin)

0.25 mg

1 mg

65271-025

65271-1

[Arg(Me2a)2, Lys(Ac)4]-Histone H3 (1-21)-GGK(Biotin)
A-R(Me2a)-T-K(Ac)-QTARKSTGGKAPRKQLAGG-K(Biotin)

0.25 mg

1 mg

65262-025

65262-1

[Arg(Me2s)2, Lys(Ac)4]-Histone H3 (1-21)-GGK(Biotin)
A-R(Me2s)-T-K(Ac)-QTARKSTGGKAPRKQLAGG-K(Biotin)

0.25 mg

1 mg

65267-025

65267-1

[Arg(Me2a)2, Lys(Me2)4]-Histone H3 (1-21)-GGK(Biotin)
A-R(Me2a)-T-K(Me2)-QTARKSTGGKAPRKQLAGG-K(Biotin)

0.25 mg

1 mg

65264-025

65264-1

[Arg(Me2s)2, Lys(Me2)4]-Histone H3 (1-21)-GGK(Biotin)
A-R(Me2s)-T-K(Me2)-QTARKSTGGKAPRKQLAGG-K(Biotin)

0.25 mg

1 mg

65269-025

65269-1

[Arg(Me2a)2, Lys(Me3)4]-Histone H3 (1-21)-GGK(Biotin)
A-R(Me2a)-T-K(Me3)-QTARKSTGGKAPRKQLAGG-K(Biotin)

0.25 mg

1 mg

65265-025

65265-1

[Arg(Me2s)2, Lys(Me3)4]-Histone H3 (1-21)-GGK(Biotin)
A-R(Me2s)-T-K(Me3)-QTARKSTGGKAPRKQLAGG-K(Biotin)

0.25 mg

1 mg

65270-025

65270-1

[Cit2]-Histone H3 (1-21)-GGK(Biotin)
A-Cit-TKQTARKSTGGKAPRKQLAGG-K(Biotin)

0.25 mg

1 mg

65237-025

65237-1

[Cit2, pThr3]-Histone H3 (1-21)-GGK(Biotin)
A-Cit-pT-KQTARKSTGGKAPRKQLAGG-K(Biotin)

0.25 mg

1 mg

65272-025

65272-1

[Cit 2/8/17]-Histone H3 (1-21)-GGK(Biotin), amide
A-Cit-TKQTA-Cit-KSTGGKAP-Cit-KQLAGG-K(Biotin)-NH2

0.25 mg

65404

[pThr3]-Histone H3 (1-21)-GGK(Biotin); H3pT3, biotin-labeled
AR-pT-KQTARKSTGGKAPRKQLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64612-025

64612-1

[Lys(Ac)4]-Histone H3 (1-21)-GGK(Biotin)
ART-K(Ac)-QTARKSTGGKAPRKQLAGG-K(biotin)

0.25 mg

1 mg

65207-025

65207-1

[Lys(Me1)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me1), biotin-labeled
ART-K(Me1)-QTARKSTGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

64355-025

64355-1

[Lys(Me2)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me2), biotin-labeled
ART-K(Me2)-QTARKSTGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

64356-025

64356-1

[Lys(Me3)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me3), biotin-labeled
ART-K(Me3)-QTARKSTGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

64357-025

64357-1

[Lys(Me3)4]-Histone H3 (1-21)-GGK(Biotin), H3K4(Me3), biotin-labeled
ART-K(Me3 -QTARKSTGGKAPRKQLA-GGK(Biotin)-NH2

1 mg

64192

[Lys(Me3)4(Ac)9]-Histone H3 (1-21), H3K4(Me3)K9(Ac), biotin-labeled
ART-K(Me3)-QTAR-K(Ac)-STGGKAPRKQLAGG-K(Biotin)-NH2

1 mg

64189

[Lys(Me3)4, Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), biotin-labeled
ART-K(Me3)-QTARKSTGG-K(Ac)-APRKQLAGG-K(Biotin)

0.25 mg

1 mg

65088-025

65088-1

[Arg(Me1)8]-Histone H3 (1-21)-K(biotin), H3R8(Me1), biotin-labeled
ARTKQTA-R(Me1)-KSTGGKAPRKQLA-K(Biotin)-NH2

0.25 mg

1 mg

64607-025

64607-1

[Arg(Me2a)8]-Histone H3(1-21)-K(Biotin), H3R8(Me2a), biotin-labeled
ARTKQTA-R(Me2a)-KSTGGKAPRKQLA-K(Biotin)-NH2

0.25 mg

1 mg

64972-025

64972-1

[Arg(Me2s)8]-Histone H3 (1-21), biotin-labeled
ARTKQTA-R(Me2s)-KSTGGKAPRKQLA-K(Biotin)

0.25 mg

1 mg

65351-025

65351-1

[Cit8]-Histone H3 (1-21)-GGK(Biotin)
ARTKQTA-Cit-KSTGGKAPRKQLAGG-K(Biotin)

0.25 mg

1 mg

65232-025

65232-1

[Lys(Ac)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Ac), biotin-labeled
ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

64361-025

64361-1

[Lys(Ac)9]-Histone H3 (1-21)-NH2, H3K9(Ac), biotin-labeled, amide
ARTKQTAR-K(Ac)-STGGKAPRKQLA-GGK(Biotin)-NH2

1 mg

64190

[Lys(Me1)9]-Histone H3 (1-21), biotin-labeled
ARTKQTAR-K(Me1)-STGGKAPRKQLA-K(Biotin)

0.25 mg

1 mg

65349-025

65349-1

[Lys(Me1)9]-Histone H3 (1-21)-K(Biotin), H3K9(Me1), biotin-labeled
ARTKQTAR-K(Me1)-STGGKAPRKQLA-K(Biotin)-NH2

0.25 mg

64539

[Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me1), biotin-labeled
ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

64358-025

64358-1

[Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin); H3K9(Me1), biotin-labeled
ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64626-025

64626-1

[Lys(Me2)9]-Histone H3 (1-21) - K(Biotin), H3K9(Me2), biotin-labeled
ARTKQTAR-K(Me2)-STGGKAPRKQLA-K(Biotin)

1 mg

63678

[Lys(Me2)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me2), biotin-labeled
ARTKQTAR-K(Me2)-STGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

64359-025

64359-1

[Lys(Me2)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me2), biotin-labeled
ARTKQTAR-K(Me2)-STGGKAPRKQLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64627-025

64627-1

[Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), biotin-labeled
ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin)

0.25 mg

1 mg

64360-025

64360-1

[Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), biotin-labeled
ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64628-025

64628-1

[Lys(Ac)9/14]-Histone H3 (1-21)-GGK(Biotin), H3K9/14(Ac), biotin-labeled
ARTKQTAR-K(Ac)-STGG-K(Ac)-APRKQLA-GGK(Biotin)

0.25 mg

1 mg

64363-025

64363-1

[pSer10]-Histone H3 (1-21)-GGK(Biotin); H3pS10, biotin-labeled
ARTKQTARK-pS-TGGKAPRKQLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64611-025

64611-1

[pSer10), Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), biotin-labeled
ARTKQTARK-pS-TGG-K(Ac)-APRKQLAGGK(Biotin)

0.25 mg

1 mg

64364-025

64364-1

[pThr11]-Histone H3(1-21)-GGK(Biotin), H3pT11, biotin-labeled
ARTKQTARKS-pT-GGKAPRKQLAGG-K(Biotin)-NH2

0.25 mg

1 mg

64973-025

64973-1

[Lys(Ac)14]-Histone H3 (1-21)-GGK(Biotin), H3K14(Ac), biotin-labeled
ARTKQTARKSTGG - K(Ac) - APRKQLA - GGK(Biotin)

0.25 mg

1 mg

64362-025

64362-1

[Lys(Me1)14]-Histone H3(1-21)-GGK(Biotin), H3K14(Me1), biotin-labeled
ARTKQTARKSTGG-K(Me1)-APRKQLAGG-K(Biotin)-NH2

0.25 mg

1 mg

64974-025

64974-1

[Lys(Me2)14]-Histone H3(1-21)-GGK(Biotin), H3K14(Me2), biotin-labeled
ARTKQTARKSTGG-K(Me2)-APRKQLAGG-K(Biotin)-NH2

0.25 mg

1 mg

64971-025

64971-1

[Lys(Me3)14]-Histone H3 (1-21) -GGK(Biotin), H3K14(Me3), biotin-labeled
ARTKQTARKSTGG-K(Me3)-APRKQLAGG-K(Biotin)-NH2

0.25 mg

1 mg

64970-025

64970-1

[Arg(Me1)17]-Histone H3 (1-21)-GGK(Biotin), H3R17(Me1), biotin-labeled
ARTKQTARKSTGGKAP-R(Me1)-KQLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64632-025

64632-1

[Arg(Me2a)17]-Histone H3 (1-21)-GGK(Biotin); H3R17(Me2a), biotin-labeled
ARTKQTARKSTGGKAP-R(Me2a)-KQLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64634-025

64634-1

[Arg(Me2s)17]-Histone H3 (1-21)-GGK(Biotin); H3R17(Me2s), biotin-labeled
ARTKQTARKSTGGKAP-R(Me2s)-KQLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64633-025

64633-1

[Cit17]-Histone H3 (1-21)-GGK(Biotin)
ARTKQTARKSTGGKAP-Cit-KQLAGG-K(Biotin)

0.25 mg

1 mg

65233-025

65233-1

[Lys(Ac)18]-Histone 3 (1-21)-GGK(Biotin); H3K18(Ac), biotin-labeled
ARTKQTARKSTGGKAPR-K(Ac)-QLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64638-025

64638-1

[Lys(Me1)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me1), biotin-labeled
ARTKQTARKSTGGKAPR-K(Me1)-QLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64621-025

64621-1

[Lys(Me2)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me2), biotin-labeled
ARTKQTARKSTGGKAPR-K(Me2)-QLA-GGK(Biotin)-NH2

0.25 mg

1 mg

64620-025

64620-1

[Lys(Me3)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me3), biotin-labeled
ARTKQTARKSTGGKAPR-K(Me3)-QLAGG-K(Biotin)-NH2

0.25 mg

1 mg

64622-025

64622-1

Histone H3 (1-24) & (1-30)

[Lys(Ac)14/18/23]-Histone H3 (1-24)-GGK(Biotin)
ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AGG-K(Biotin)

0.25 mg

1 mg

65235-025

65235-1

[Lys(Ac)14/23]-Histone H3 (1-24)-GGK(Biotin)
ARTKQTARKSTGG-K(Ac)-APRKQLAT-K(Ac)-AGG-K(Biotin)

0.25 mg

1 mg

65236-025

65236-1

[Lys(Ac)14/18/23/27]-Histone H3 (1-30)-GGK(Biotin)
ARTKQTARKSTGG-K(Ac)-APR-K(Ac)-QLAT-K(Ac)-AAR-K(Ac)-SAPGG-K(Biotin)

0.25 mg

1 mg

65227-025

65227-1

Histone H3 (1-50) & (1-55)

Histone H3 (1-50)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALRE

0.25 mg

1 mg

65367-025

65367-01

Histone H3 (1-50)-GGK(Biotin), biotin-labeled
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREGG-K(Biotin)

0.25 mg

1 mg

65366-025

65366-01

Histone H3 (1-55), biotin-labeled, acetylated
Ac - ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYR
PGTVALREIRRYQ-K(LC-Biotin)-NH2

0.25 mg

1 mg

65362-025

65362-01

Histone H3 (15-36), (15-39) & (21-43)

[Arg(Me1)26]-Histone H3 (15-36)-K(Biotin), H3R26(Me1), biotin-labeled
APRKQLATKAA-R(Me1)-KSAPATGGVK-K(Biotin)-NH2

0.25 mg

1 mg

64608-025

64608-1

[Arg(Me2a)26]-Histone H3 (15-36)-GGK(Biotin)
APRKQLATKAA-R(Me2a)-KSAPATGGVKGG-K(Biotin)

0.25 mg

1 mg

65261-025

65261-1

[Lys(Me1)27]-Histone H3 (15-39)-K(Biotin), H3K27(Me1), biotin-labeled
APRKQLATKAAR-K(Me)-SAPATGGVKKPH-K(Biotin)-NH2

0.25 mg

64540

[Lys(Ac)27]-Histone H3 (21-43)-GGK(Biotin), H3K27(Ac), biotin-labeled
ATKAAR-K(Ac)-SAPATGGVKKPHRYRPGG-K(Biotin)

0.25 mg

1 mg

64846-025

64846-1

Histone H3 (21-44)

Histone H3 (21-44)
ATKAARKSAPATGGVKKPHRYRPG

1 mg

64454-1

Histone H3 (21-44)-GK(Biotin), biotin-labeled
ATKAARKSAPATGGVKKPHRYRPG-GK(Biotin)

0.25 mg

1 mg

64440-025

64440-1

Histone H3 (21-44) - GK(Biotin), biotin-labeled, amide
ATKAARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2

0.25 mg

1 mg

64641-025

64641-1

[Lys(Ac)23]-Histone H3 (21-44)-GK(Biotin); H3K23(Ac), biotin-labeled
AT-K(Ac)-AARKSAPATGGVKKPHRYRPGG-K(Biotin)

0.25 mg

1 mg

65241-025

65241-1

[Lys(Me1)23]-Histone H3 (21-44)-GK(Biotin); H3K23(Me1), biotin-labeled
AT-K(Me1)-AARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2

0.25 mg

1 mg

64617-025

64617-1

[Lys(Me2)23]-Histone H3 (21-44)-GK(Biotin), H3K23(Me2), biotin-labeled
AT-K(Me2)-AARKSAPSTGGVKKPHRYRPGG-K(Biotin)-NH2

0.25 mg

1 mg

64618-025

64618-1

[Lys(Me3)23]-Histone H3 (21-44)-GK(Biotin); H3K23(Me3), biotin-labeled
AT-K(Me3)-AARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2

0.25 mg

1 mg

64619-025

64619-1

[Cit26]-Histone H3 (21-44)-GGK(Biotin)
ATKAA-Cit-KSAPATGGVKKPHRYRPGGG-K(Biotin)

0.25 mg

1 mg

65234-025

65234-1

[Lys(Ac)27]-Histone 3 (21-44)-GK(Biotin); H3K27(Ac), biotin-labeled
ATKAAR-K(Ac)-SAPSTGGVKKPHRYRPG-GK(Biotin)-NH2

0.25 mg

1 mg

64637-025

64637-1

[Lys(Me1)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me1), biotin-labeled
ATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin)

0.25 mg

1 mg

64365-025

64365-1

[Lys(Me2)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me2), biotin-labeled
ATKAAR-K(Me2)-SAPATGGVKKPHRYRPG-GK(Biotin)

0.25 mg

1 mg

64366-025

64366-1

[Lys(Me3)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me3), biotin-labeled
ATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-GK(Biotin)

0.25 mg

1 mg

64367-025

64367-1

[Lys(Me3)27]-Histone H3 (21-44), biotin-labeled
ATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-K(Biotin)

0.25 mg

1 mg

65347-025

65347-1

[pSer28]-Histone H3 (21-44)-GK(Biotin), biotin-labeled
ATKAARK-pS-APATGGVKKPHRYRPG-GK(Biotin)

0.25 mg

1 mg

65369-025

65369-1

[Lys(Ac)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Ac), biotin-labeled
ATKAARKSAPATGGV-K(Ac)-KPHRYRPG-GK(Biotin)

0.25 mg

1 mg

64936-025

64936-1

[Lys(Me1)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me1), biotin-labeled
ATKAARKSAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)

0.25 mg

1 mg

64368-025

64376-1

[Lys(Me2)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me2), biotin-labeled
ATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin)

0.25 mg

1 mg

64442-025

64442-1

[Lys(Me3)36]-Histone H3 (21-44)-GK(Biotin), H3K36(Me3), biotin-labeled
ATKAARKSAPATGGV-K(Me3)-KPHRYRPG-GK(Biotin)

0.25 mg

1 mg

64441-025

64441-1

Histone H3 (23-34) & (26-46)

Histone H3 (23-34)
KAARKSAPATGG

1 mg

64375-1

[Lys(Me3)27-Histone H3 (23-34)-GGK(Biotin)
KAAR-K(Me3)-SAPATGG-GGK(Biotin)

1 mg

65397

[Lys(Me1)36]-Histone H3 (26-46)-K(Biotin), H3K36(Me1)
RKAAPATGGV-K(Me1)-KPHRYRPGTV-K(BIOTIN)

0.25 mg

1 mg

64602-025

64602-1

[Lys(Me2)36]-Histone H3 (26-46), H3K36(Me2)
RKAAPATGGV - K(Me2) - KPHRYRPGTV - K(BIOTIN)

0.25 mg

1 mg

64601-025

64601-1

[Lys(Me3)36]-Histone H3 (26-46)-K(Biotin), H3K36(Me3), biotin-labeled
RKAAPATGGV-K(Me3)-KPHRYRPGTV-K(BIOTIN)

0.25 mg

1 mg

64600-025

64600-1

Histone H3 (44-63) & (58-89)

Histone H3 (44-63)-GGK(Biotin), biotin-labeled
GTVALREIRRYQKSTELLIR-GGK(Biotin)-NH2

0.25 mg

1 mg

64642-025

64642-1

[Lys(Me1)79]-Histone H3 (58-89)-GGK(Biotin)
TELLIRKLPFQRLVREIAQDF-K(Me1)-TDLRFQSAAIGG-K(Biotin)

0.25 mg

1 mg

65224-025

65224-1

[Lys(Me2)79]-Histone H3 (58-89)-GGK(Biotin)
TELLIRKLPFQRLVREIAQDF-K(Me2)-TDLRFQSAAIGG-K(Biotin)

0.25 mg

1 mg

65228-025

65228-1

[Lys(Me3)79]-Histone H3 (58-89)-GGK(Biotin)
TELLIRKLPFQRLVREIAQDF-K(Me3)-TDLRFQSAAIGG-K(Biotin)

0.25 mg

1 mg

65250-025

65250-1

Histone H3 (69-89)

Histone H3 (69-89)-K(Biotin)
RLVREIAQDFKTDLRFQSSAV-K(Biotin)

0.25 mg

1 mg

65297-025

65297-1

[Lys(Me1)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me1), biotin-labeled
RLVREIAQDF-K(Me1)-TDLRFQSSAV-K(Biotin)

0.25 mg

1 mg

64543

[Lys(Me2)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me2), biotin-labeled
RLVREIAQDF-K(Me2)-TDLRFQSSAV-K(Biotin)

0.25 mg

64544

[Lys(Me3)79]-Histone H3 (69-89)-K(Biotin), H3K79(Me3), biotin-labeled
RLVREIAQDF-K(Me3)-TDLRFQSSAV-K(biotin)

0.25 mg

64545-025

[Lys(Me3)79,pThr80]-Histone H3 (69-89)-K(Biotin)
RLVREIAQDF-K(Me3)-pT-DLRFQSSAV-K(Biotin)

0.25 mg

1 mg

65300-025

65300-1



Figure 4. Histone H4 (1-21) sequence and the available single or combination PTM amino acids. Listings of H4 sequences such as (1-23) and (1-25) can be found in Table 4.

Table 4. Listing of H4 biotin-labeled Peptides.

Product

Size

Catalog #

Histone H4 (1-21)

Histone H4 (1-21)
SGRGKGGKGLGKGGAKRHRKV

1 mg

62499

Histone H4 (1-21)-Lys(Biotin)
Ac-SGRGKGGKGLGKGGAKRHRKV-GGK(Biotin)

1 mg

62555

[pSer1]-Histone H4(1-21)-GGK(Biotin), H4pS1, biotin-labeled
Ac-pS-GRGKGGKGLGKGGAKRHRKV-GGK(Biotin)

0.25 mg

1 mg

64975-025

64975-1

[Arg(Me1)3]-Histone H4(1-21)-GGK(Biotin), H4R3(Me1), biotin-labeled
Ac-SG-R(Me1)-GKGGKGLGKGGAKRHRKV-GGK(Biotin)

0.25 mg

1 mg

64977-025

64977-1

[Arg(Me2a)3]-Histone H4(1-21)-GGK(Biotin), H4R3(Me2a), biotin-labeled
Ac-SG-R(Me2a)-GKGGKGLGKGGAKRHRKV-GGK(Biotin)

0.25 mg

1 mg

64976-025

64976-1

[Lys(Ac)5]-Histone H4 (1-21)-GGK(Biotin), H4K5(Ac), biotin-labeled
Ac-SGRG-K(Ac)-GGKGLGKGGAKRHRKVGG-K(Biotin)

0.25 mg

1 mg

64844-025

64844-1

[Lys(Ac)5/8/12/16]-Histone H4 (1-21)-GGK(Biotin), H4K5/8/12/16(Ac), biotin- labeled
SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVGG-K(Biotin)

0.25 mg

1 mg

64989-025

64989-1

[Lys(Ac)8]-Histone H4 (1-21)-GGK(Biotin), H4K8(Ac), biotin-labeled
Ac-SGRGKGG-K(Ac)-GLGKGGAKRHRKV-GGK(Biotin)

0.25 mg

1 mg

64843-025

64843-1

[Lys(Ac)12]-Histone H4 (1-21)-GGK(Biotin), H4K12(Ac), biotin-labeled
Ac-SGRGKGGKGLG-K(Ac)-GGAKRHRKVGG-K(Biotin)

0.25 mg

1 mg

64849-025

64849-1

[Lys(Me1)12]-Histone H4(1-21)-GGK(Biotin), H4K12(Me1), biotin-labeled
Ac - SGRGKGGKGLG-K(Me1)-GGAKRHRKVGG-K(Biotin)

0.25 mg

1 mg

64980-025

64980-1

[Lys(Me2)12]-Histone H4(1-21)-GGK(Biotin), H4K12(Me2), biotin-labeled
Ac - SGRGKGGKGLG-K(Me2)-GGAKRHRKVGG-K(Biotin)

0.25 mg

1 mg

64978-025

64978-1

[Lys(Me3)12]-Histone H4(1-21)-GGK(Biotin), H4K12(Me3), biotin-labeled
Ac-SGRGKGGKGLG-K(Me3)-GGAKRHRKVGG-K(Biotin)

0.25 mg

1 mg

64979-025

64979-1

[Lys(Ac)16]-Histone H4 (1-21)-GGK(Biotin), H4K16(Ac), biotin-labeled
Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKVGG-K(Biotin)

0.25 mg

1 mg

64847-025

64847-1

[Lys(Ac)16]-Histone H4 (1-21)-WGK(Biotin)
Ac-SGRGKGGKGLGKGGA-K(Ac)-RHRKVWG-K(Biotin)

1 mg

65330-1

Histone H4 (1-23)

Histone H4 (1-23)-GSGSK, C-terminal biotin-labeled
SGRGKGGKGLGKGGAKRHRKVLRGSGS-K(Biotin)

1 mg

65002

Histone H4 (1-23)-GGK(Biotin), biotin labeled, amide
SGRGKGGKGLGKGGAKRHRKVLRGG-K(Biotin)-NH2

1 mg

65097

[pSer1]-Histone H4 (1-23)-GGK(Biotin)
pS-GRGKGGKGLGKGGAKRHRKVLRGG-K(Biotin)

0.25 mg

1 mg

65256-025

65256-1

[Arg(Me1)3]-Histone H4 (1-23)-GGK(Biotin)
SG-R(Me1)-GKGGKGLGKGGAKRHRKVLRGG-K(Biotin)

0.25 mg

1 mg

65277-025

65277-1

[Arg(Me2s)3]-Histone H4 (1-23)-GGK(Biotin)
SG-R(Me2s)-GKGGKGLGKGGAKRHRKVLRGG-K(Biotin)

0.25 mg

1 mg

65276-025

65276-1

[Arg(Me2a)3]-Histone H4 (1-23)-GGK(Biotin)
SG - R(Me2a) - GKGGKGLGKGGAKRHRKVLRGG - K(Biotin)

0.25 mg

1 mg

65278-025

65278-1

[Cit3]-Histone H4 (1 -23)-GGK(Biotin)
SG - Cit - GKGGKGLGKGGAKRHRKVLRGG - K(Biotin)

0.25 mg

1 mg

65275-025

65275-1

[Lys(Me1)20]-Histone H4 (1-23)-GGK(Biotin), H3K20(Me1), biotin-labeled
SGRGKGGKGLGKGGAKRHR-K(Me1)-VLR-GGK(Biotin)-NH2

0.25 mg

1 mg

64623-025

64623-1

[Lys(Me2)20]-Histone H4 (1-23)-GGK(Biotin), H3K20(Me2), biotin-labeled
SGRGKGGKGLGKGGAKRHR-K(Me2)-VLR-GGK(Biotin)-NH2

0.25 mg

1 mg

64624-025

64624-1

[Lys(Me3)20]-Histone H4 (1-23)-GGK(Biotin), H3K20(Me3), biotin-labeled
SGRGKGGKGLGKGGAKRHR-K(Me3)-VLR-GGK(Biotin)-NH2

0.25 mg

1 mg

64625-025

64625-1

Histone H4 (1-25)

Histone H4 (1-25)-GSGSK(Biotin)
SGRGKGGKGLGKGGAKRHRKVLRDNGSGS-K(Biotin)

0.25 mg

1 mg

65242-025

65242-1

[Lys(Ac)5]-Histone H4 (1-25)-GSGSK(Biotin); H4K5(Ac), biotin-labeled
SGRG-K(Ac)-GGKGLGKGGAKRHRKVLRDNGSGS-K(Biotin)

0.25 mg

1 mg

65229-025

65229-1

[Lys(Ac)8]-Histone H4 (1-25)-GSGSK(Biotin); H4K8(Ac), biotin-labeled
SGRGKGG-K(Ac)-GLGKGGAKRHRKVLRDNGSGS-K(Biotin)

0.25 mg

1 mg

65230-025

65230-1

[Lys(Ac)5/8/12/16]-Histone H4 (1-25)-GSGSK(Biotin)
SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGS-K(Biotin)

0.25 mg

1 mg

65248-025

65248-1

[Lys(Ac)12]-Histone H4 (1-25)-GSGSK(Biotin); H4K12(Ac), biotin-labeled
SGRGKGGKGLG-K(Ac)-GGAKRHRKVLRDNGSGS-K(Biotin)

0.25 mg

1 mg

65208-025

65208-1

[Lys(Ac)12/16]-Histone H4(1-25)-GSGSK(Biotin); H4K12/16(Ac), biotin-labeled
SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGS-K(Biotin)

0.25 mg

1 mg

65222-025

65222-1

[Lys(Ac)12/16, Lys(Me1)20]-Histone H4 (1-25)-GSGSK(Biotin)
SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHR-K(Me1)-VLRDNGSGS-K(Biotin)

0.25 mg

1 mg

65225-025

65225-1

[Lys(Ac)16]-Histone H4 (1-25)-GSGSK(Biotin); H4K16(Ac), biotin-labeled
SGRGKGGKGLGKGGA-K(Ac)-RHRKVLRDNGSGS-K(Biotin)

0.25 mg

1 mg

65209-025

65209-1

[Lys(Ac)16, Lys(Me1)20]-Histone H4 (1-25)-GSGSK(Biotin)
SGRGKGGKGLGKGGA-K(Ac)-RHR-K(Me1)-VLRDNGSGS-K(Biotin)

0.25 mg

1 mg

65210-025

65210-1

[Lys(Ac)12/16, Lys(Me3)20]-Histone H4 (1-25)-GSGSK(Biotin)
SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHR-K(Me3)-VLRDNGSGS-K(Biotin)

0.25 mg

1 mg

65226-025

65226-1

[Lys(Ac)20]-Histone H4 (1-25)-GSGSK(Biotin); H4K20(Ac), biotin-labeled
SGRGKGGKGLGKGGAKRHR-K(Ac)-VLRDNGSGS-K(Biotin)

0.25 mg

1 mg

65212-025

65212-1

Related Products:

Histone H1 Peptides - Full Listing

Histone H2A Peptides - Full Listing

Histone H2B Peptides - Full Listing

Histone H3 Peptides – Full Listing

Histone H4 Peptides - Full Listing

Histone Related Substrates – Full Listing
SensoLyte® Histone H3 (1 - 21) Sampler Kit *Biotinylated*
SensoLyte® Methylated Histone H3 (1 - 21) Sampler Kit *Biotinylated*
SensoLyte® 520 HDAC Assay Kit
SensoLyte® 440 HDAC Assay Kit
SensoLyte® LSD1 Assay Kit
SensoLyte® 520 Deubiquitination Assay Kit
SensoLyte® 440 Deubiquitination Assay Kit
SensoLyte® 520 FRET SIRT1 Assay Kit
SensoLyte® Green SIRT1 Assay Kit
SensoLyte® 520 FRET SIRT2 Assay Kit
SensoLyte® Green SIRT2 Assay Kit
SensoLyte® HAT (p300) Assay Kit
SensoLyte® HAT (pCAF) Assay Kit
Monoclonal Antibody against 5-Methylcytidine

References:

1. Protocol Online http://www.protocol-online.org/cgi-bin/prot/view_cache.cgi?ID=4089.

2. Wysocka, J. Methods 40, 339 (2006).