Anti-Tau Antibody (GlcNAc Ser400) & Tau Peptides - NEW


Tau is a microtubule-associated protein that stabilizes and promotes microtubule assembly. In the human brain, it is present in six isoforms that are 352, 381, 383, 410, 412, and 441 amino acids in length.1-5 When Tau is hyperphosphorylated, it can detach and form paired helical filament (PHF) aggregates.2-5 PHFs were found in neurofibrillary tangles in Alzheimer’s disease (AD) patients. As such, hyperphosphorylation of Tau has been linked to AD. In addition to being modified with phosphate groups, Tau can also undergo glycosylation on the same regions where phosphorylation takes place.5 Discovery of this phenomenon has led to the hypothesis that glycosylation of Tau may help stabilize microtubule-Tau connection and prevent free Tau aggregation.

Anti-Tau Antibody (GlcNAc Ser400) & Anti-Tau Antibody (Ser400)

AnaSpec recently released a polyclonal antibody that recognizes the glycosylated [N-acetyl-D-glucosamine (GlcNAc)] Serine400 residue. Anti-Tau Antibody (GlcNAc Ser400) was raised against a synthetic peptide derived from amino acids surrounding the Tau Ser400 sequence. As confirmed by Western and dot blots, this antibody only recognizes Tau glycosylated Ser400 and not the non-glycosylated Tau. Species reactivity includes human, monkey, mouse, rat, and other mammalian species.

Anti-Tau Antibody (GlcNAc Ser400)

Anti-Tau Antibody (Ser400)

Product

Size

Catalog #

Anti-Tau Antibody (GlcNAc Ser400), Rabbit Polyclonal NEW

50 µg

55945

Anti-Tau Antibody (Ser400), Rabbit Polyclonal NEW

50 µg

55944

Related Products:

Product

Size

Catalog #

[Ser(OGlcNAc)]400 - KWK - Tau (388 - 411) - KK(Biotin) - NH2 Peptide NEW
KWKHGAEIVYKSPVV - S(OGlcNAc) - GDTSPRHLSNVK - K(biotin) - NH2

0.25 mg

1 mg

65409-025

65409-1

Anti-Tau antibodies (phospho & non-phospho specific) – Wide Selection
Anti-Tau Blocking Peptides (phospho & non-phospho)


Tau Peptides

In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat (3R) or four repeat (R4) domains, in addition to the presence or absence of one or two insert domains at the amino-terminus.

Six Tau peptides with sequences from N-terminal inserts and C-terminal repeat domains have recently been released. Shown below is a schematic representation from Tau Peptide (45-73). This is a 29-amino acid long peptide derived from the Exon 2/Insert 1 domain.

Product

Size

Catalog #

Tau Peptide (45 - 73) (Exon 2/Insert 1 domain) NEW
ESPLQTPTEDGSEEPGSETSDAKSTPTAE

1 mg

5 mg

65431-1

65431-5

Tau Peptide (74 - 102) (Exon 3/Insert 2 domain) NEW
DVTAPLVDEGAPGKQAAAQPHTEIPEGTT

1 mg

5 mg

65432-1

65432-5

Tau Peptide (244 - 274) (Repeat 1 domain) NEW
Ac-QTAPVPMPDLKNVKSKIGSTENLKHQPGGGK

1 mg

5 mg

65433-1

65433-5

Tau Peptide (275 - 305) (Repeat 2 domain) NEW
VQIINKKLDLSNVQSKCGSKDNIKHVPGGGS

1 mg

5 mg

65434-1

65434-5

Tau Peptide (306 - 336) (Repeat 3 domain) NEW
VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ

1 mg

5 mg

65435-1

65435-5

Tau Peptide (337 - 368) (Repeat 4 domain) NEW
VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN

1 mg

5 mg

65436-1

65436-5

Related Products

Product

Size

Catalog #

Tau - Protein (1 - 16)
MAEPRQEFEVMEDHAG

1 mg

62959

Tau - Protein (323 - 335)
GSLGNIHHKPGGG

1 mg

62958

β-Amyloid Peptides – Industry’s Largest Selection

SensoLyte® β-Amyloid (1-40) & (1-42) ELISA kits – human & mouse/rat

SensoLyte®ThT Aβ42 & Aβ40 Aggregation kits

References:

1.Goedert, M. et al. Neuron, 3, 519 (1989).

2. Evans, DB. et al. JBC 275, 24977 (2000).

3.Luc, B. et al. Brain Res Rev 33, 95 (2000).

4. Arai, T. et al. JBC 280, 5145 (2005).

5. Yuzwa, SA. et al. Amino Acid 40, 857 (2011).