Cathelicidins – Diverse Selection


Cathelicidins are cationic peptides that have broad-range antimicrobial activity.1 These peptides belong to the family of anti-microbial peptides which form part of the host’s important innate immunity mechanism.2 In humans, cathelicidins and defensins are expressed in immune cells and at epithelial surfaces.3-5 hCAP18, human cationic antimicrobial protein, with a MW of 18 kD, is the only cathelicidin gene found in humans.2 The N-terminus of this protein consists of a cathelin-like region (similar to the other members of the cathelicidin family) and a C-terminal termed LL-37.6-7 An amphipathic alpha-helical peptide, LL-37 plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.8-9

Offering one of the world’s largest collections of catalog peptides, AnaSpec is pleased to introduce a wide range of structurally diverse cathelicidin peptides, some of which have not been commercially available until now.

Request AnaSpec’s newest Peptides catalog

Product

Size

Catalog #

LL-37; Antimicrobial Peptide, human

[LL-37, 37 aa]

1 mg

61302

LL-37, reverse sequence

SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL

0.5 mg

62208

LL-37 pentamide10

LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS; more potent than LL-37

1 mg

61309

RL-3710

RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS; Rhesus monkey

0.5 mg

61313

mCRAMP; mouse11

GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ; mouse cathelicidin-related antimicrobial peptide

1 mg

61305

rCRAMP12

GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ; rat cathelicidin-related antimicrobial peptide

1 mg

61306

SMAP 29, Sheep Myeloid Antimicrobial Peptide 2913

RGLRRLGRKIAHGVKKYGPTVLRIIRIAG

1 mg

61308

CAP-18; rabbit14

GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY

1 mg

61307

Bactenecin, bovine15

RLCRIVVIRVCR (Disulfide bridge: 3-11); Proline and arginine rich

0.5 mg

61066

Indolicidin16

ILPWKWPWWPWRR-NH2; tryptophan-rich & found to be an inhibitor of HIV-1 reverse transcriptase and integrase17

1 mg

60999

To view our complete list of anti-microbial peptides, please click here.

Related Peptide Products:

· Defensins
· Histatins
· Cecropins
· Magainins
· Ovispirins
· Cathepsin substrates

References:

1. Zanetti, M. et al. J. Biol. Chem. 268, 522 (1993).
2. Lehrer, R. and T. Ganz. Curr. Opin. Immunol. 11, 23 (1999).
3. Ganz, T. Nat. Rev. Immunol. 3, 710 (2003).

4. Zanetti, M. J. Leukoc. Biol. 75, 39 (2004).
5. Chromek, M. et al. Nature Medicine 12, 636 (2006).
6. Zanetti, M. et al. FEBS Lett. 374, 1 (1995).
7. Sorensen, OE. et al. Blood 97, 3951 (2001).
8. Neville, F. et al. Biophys. J. 90, 1275 (2006)
9. Oren, Z., et al. Biochem. J. 341, 501(1999).
10. Zhao, C. et al. Antimicrob. Ag. Chemother. 45, 2695 (2001).
11. Lopez-Garcia, B. et al. J. Invest. Dermatol. 125, 108 (2005).
12. Termen, S. et al. Cell. Mol. Life Sci. 60, 536 (2003).
13. Saiman, L et al. Antimicrob. Ag. Chemother. 45, 2838 (2001).
14. Travis, S et al. Infect. Immun. 68, 2748 (2000).
15. Wu, M. and REW Hancock J. Biol. Chem. 274, 29 (1999).
16. Selsted, ME. et al. J. Biol. Chem. 267, 4292 (1992).
17. de Soul
trait VR. et al. Curr. Med. Chem. 10, 1765 (2003).