LL-37 Peptides are GO™


LL-37 peptides are AnaSpec’s latest addition to our expansive collection of research-ready, on-demand GO™ Peptides. The LL-37 GO™ collection includes LL-37 fragments consisting of 8-37 and 18-37; FAM, biotin-LC-labeled LL-37 (LC is a 6-carbon linker); and Cys-LC-LL-37 - useful in applications such as conjugation to resin. Sepharose linked LL-37 is available as a custom order. New antimicrobial peptides (AMP) include Dermcidin, DCD-1L and mCRAMP, biotin-LC labeled.

Cathelicidins are cationic peptides that have broad-range antimicrobial activity.1 These peptides belong to the family of anti-microbial peptides which form part of the host’s important innate immunity mechanism.2 In humans, cathelicidins and defensins are expressed in immune cells and at epithelial surfaces.3-5 hCAP18, human cationic antimicrobial protein, with a MW of 18 kD, is the only cathelicidin gene found in humans.2 The N-terminus of this protein consists of a cathelin-like region (highly conserved among species) and a C-terminal termed LL-37.6-7 An amphipathic alpha-helical peptide, LL-37 plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells, LL-37 is significantly resistant to proteolytic degradation in solution.8-9 In addition to having antimicrobial activity, LL-37 has been shown to play a role in chemoattraction, dendritic cell differentiation, mast cell degranulation, cytokine secretion, angiogenesis stimulation, and wound healing.10 In other species, the C-terminal antimicrobial region varies in sizes, sequences and structures. 10



Click here for more information.

 Product

Size

Catalog #

LL - 37, Antimicrobial Peptide, human

[LL-37, 37 aa]

1 mg

61302

LL-37, acetylated & amidated NEW

Ac-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-NH2

1 mg

63710

LL-37 fragment (8-37), LL-8-37 NEW

KSKEKIGKEFKRIVQRIKDFLRNLVPRTES

1 mg

63711

LL-37 fragment (18-37), LL-18-37 NEW

KRIVQRIKDFLRNLVPRTES

1 mg

63712

5 - FAM - LC - LL - 37  NEW

5-FAM-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

0.1 mg

63694

Biotin - LC - LL - 37  NEW

Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

0.5 mg

63693

Cys - LC - LL - 37  NEW

C-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

1 mg

63692

LL - 37, reverse sequence

SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL

0.5 mg

62208

LL-37, scrambled NEW

GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR

1 mg

63708

LL - 37 pentamide

LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS; more potent than LL-37

1 mg

61309

Dermcidin, DCD-1L NEW

SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL

0.5 mg

63713

RL-37
RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS
; Rhesus monkey

0.5 mg

61313

mCRAMP, mouse
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
; mouse cathelicidin-related antimicrobial peptide

1 mg

61305

mCRAMP, biotin-LC labeled   NEW
Biotin-LC-GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ

0.5 mg

1 mg

63709-05

63709-1

rCRAMP
GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
; rat cathelicidin-related antimicrobial peptide

1 mg

61306

To view our complete list of anti-microbial peptides (AMPs), please click here.

Related Products:

Peptides:

·    Defensins
·    Histatins
·    Cecropins
·    Magainins
·    Ovispirins
·    Cathepsin Substrates

Assay Kits:

·    SensoLyte Cathepsin D Assay Kits
·    SensoLyte Cathepsin S Assay Kits
·    DHL Cell Cytotoxicity Assay Kits

Request AnaSpec’s soon to be released GOTM Peptides listing

References:

1. Zanetti, M. et al. J. Biol. Chem. 268, 522 (1993).
2.
Lehrer, R. and T. Ganz. Curr. Opin. Immunol. 11, 23 (1999).
3. Ganz, T. Nat. Rev. Immunol. 3, 710 (2003).
4. Zanetti, M. J. Leukoc. Biol. 75, 39 (2004).
5. Chromek, M. et al. Nature Medicine 12, 636 (2006).

6. Zanetti, M. et al. FEBS Lett. 374, 1 (1995).
7. Sorensen, OE. et al.
Blood 97, 3951 (2001).
8. Neville, F. et al. Biophys. J. 90, 1275 (2006)
9. Oren, Z., et al.
Biochem. J. 341, 501(1999).
10. Gordon, YJ. et al. Curr. Eye Res. 30, 385 (2005).