Cell Penetrating Peptides (CPP) are GO™


Efficient transfer of proteins or nucleic acids across cellular membranes is one of the technical challenges in cell biology. To deliver the functional domain of a selected protein from the outside to the inside of intact cells, a carrier is needed. Cell Penetrating Peptides (CPPs), also known as Protein Transduction Domains (PTDs), are carriers with small peptide domains that can freely cross cell membranes. Several PTDs have been identified that allow a fused protein to efficiently cross cell membranes in a process known as protein transduction. Studies have demonstrated that a TAT peptide derived from the HIV TAT protein has the ability to transduce peptides or proteins into various cells.

AnaSpec's GO® Peptides include a vast offering of CPPs. We have CPPs such as Poly-Arg, Antennapedia, TAT, Transportan and others. These peptides are available as green fluorescent labeled (e.g. FAM or FITC), red labeled (e.g. TAMRA), Cys conjugated or Cys(Npys) conjugated. Npys stands for 3-nitro-2-pyridinesulfenyl. The Npys group of a cysteine-containing peptide is capable of reacting selectively with the free thiol group of another cysteine-containing peptide to afford an unsymmetrical disulfide bond. This results in the conjugation of the CPP with the peptide cargo (Table 1).

Recent releases of CPPs include two Beclin-1, TAT conjugated peptides for use in autophagy research (Table 2). Newly released CPP's also include KALA, Maurocalcine and others (Table 3).

For custom synthesis of CPP peptides, email us or request an online price quotation.

Request additional information

 

Table 1. A listing of (Arg)9, Antennapedia and TAT peptides.

Cell Penetrating Peptides (CPP)

(Arg)9
RRRRRRRRR

Antennapedia
RQIKIWFQNRRMKWKK - NH2

TAT
YGRKKRRQRRR

CPP

61204

61033

60023-1, 60023-5

FITC-LC-CPP

24175, 24176

27042, 27043

FAM-labeled CPP

61207

61210

TAMRA-labeled CPP

61208

61211

Cys-CPP

61212

Cys(Npys)-CPP

61205

61034

61214

Cys(Npys)-CPP, FAM-labeled

61213

Biotin-CPP

61209

 

Table 2. Beclin-1 conjugated to Tat for autophagy research.

Product

Catalog #

Tat - Beclin - 1 NEW
YGRKKRRQRRRGGTNVFNATFHIWHSGQFGT

65467

Tat - Beclin - 1, scrambled NEW
YGRKKRRQRRRGGVGNDFFINHETTGFATEW

65468

Related Products:

Beclin - 1 Peptide TNVFNATFHIWHSGQFGT NEW

Anti-MAP1-LC3 α/β (IN), polyclonal antibody

Table 2. Other recently introduced CPP's.

Product

Catalog #

hCT (Calcitonin) NEW
LGTYTQDFNKFHTFPQTAIGVGAP

65458

KALA NEW
WEAKLAKALAKALAKHLAKALAKALKACEA

65459

MAP (KLAL) NEW
KLALKLALKALKAALKLA

65460

Maurocalcine NEW
GDC(acm)LPHLKLC

65461

NRTN (Neurturin) NEW
GAAEAAARVYDLGLRRLRQRRRLRRERVRA

65462

P1 NEW
MGLGLHLLVLAAALQGAWSQPKKKRKV

65463

Penetratin - Arg NEW
RQIRIWFQNRRMRWRR

65464

pVEC (Cadherin - 5) NEW
LLIILRRRIRKQAHAHSK

65465


Time-lapse video of FITC-LC-Antennapedia peptide (cat# 24175, 24176) entry into a neuronal cluster of cells. Video courtesy of Dr. E. Gruenstein, Univ. of Cincinnati Medical School, Cincinnati, OH.


Figure 1. Uptake of CPP by HeLa cells. HeLa cells were incubated with OptiMEM medium containing 10 uM FITC-LC-Antennapedia, cat# 24175, 24176 (panel A) and 10 uM of TAMRA-labelled TAT (47-57), cat# 61211(B) for 1 h, washed and analyzed by fluorescence microscopy.

Other CPP's:

Product

Size

Catalog #

Cys(Npys) - (D - Arg)9
C(Npys)rrrrrrrrr - NH2

1 mg

61206

Antennapedia Leader Peptide (CT)
KKWKMRRNQFWVKVQRG

1 mg

61376

Antennapedia Peptide, acid
RQIKIWFQNRRMKWKK

1 mg

61032

Anti - BetaGamma (MPS - Phosducin - like protein C terminus)
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE

0.5 mg

1 mg

24177

24178

Pep - 1: Chariot (Non - Covalent Delivery of Peptides and Proteins)
KETWWETWWTEWSQPKKKRKV
1 mg
61253

Pep - 1 - Cysteamine
Ac-KETWWETWWTEWSQPKKKRKV-cysteamine

1 mg

63849

TAT (47 - 57) - Lys(TAMRA)
YGRKKRRQRRR-K(TAMRA)

1 mg

62056

TAT (47 - 57) GGG - Cys(Npys)
YGRKKRRQRRRGGG - C(Npys) - NH2

1 mg

61215

Transdermal Peptide
ACSSSPSKHCG

1 mg

62066

Transportan
GWTLNSAGYLLGKINLKALAALAKKIL

1 mg

61256

For a full listing of AnaSpec's wide selection of CPPs, please click here.

Examples of peptides conjugated to (Arg)9:

Bid BH3 - R9 (Poly-Arg on N-terminus)
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) (Poly-Arg on C-terminus)

References: Embury, J. et al. Diabetes 50, 1706 (2001), Wang, H. et al. J. Clin. Invest. 109, 1463 (2002); Lin, Y-Z. J. Biol. Chem. 270, 14255 (1995); Holzberg, D. et al. J. Biol. Chem. 278, 40213 (2003); Williams, E. et al. J. Biol. Chem. 272, 22349 (1997); Nakatani, KH. et al. Nat. Med. 10, 1128 (2004); Mortlock, A. et al. Nucleic Acids Res. 31, e152 (2003); Kaneto, H. et al. Nat. Med. 10, 1128 (2004); Wang, JL. et al. Cancer Res. 60, 1498 (2000); Oess S. and E. Hildt, Gene. Ther. 7, 750 (2000); Dunican, D. et al. Cell Growth Diff. 12, 255 (2001).