Atrial Natriuretic Peptides (ANP)


AnaSpec, EGT Group provides a wide range of GO(catalog) natriuretic peptides for use in research laboratories. Our selection of atrial natriuretic peptides (ANPs) include the biologically active 1-28 amino acid peptide (human/porcine or rat sequences); shorter ANP fragments; and Biotin, FAM and TAMRA labeled human/porcine ANP (1-28). Brain natriuretic peptide (BNP) and C-type natriuretic peptide (CNP) are also available.

Wide selection of ANP peptides
ANPs human/porcine, rat, chicken sequences
ANPs biotin, FAM & TAMRA labeled peptides
BNP & CNP peptides

Natriuretic peptides are a family of naturally occurring proteins that play a major role in down-regulating the activity of the renin-angiotensin-aldosterone system; regulating circulatory homeostasis; modulating cardiovascular system, causing natriuresis and vasodilatation. There are at least three major natriuretic peptides that have been discovered: atrial natriuretic peptide (ANP)- secreted largely by the atria; brain natriuretic peptide (BNP) - produced by the ventricles and C-type natriuretic peptide (CNP)- located in peripheral blood vessels.

Table 1. Listing of atrial natriuretic peptides (ANPs).

Product

Size

Catalog #

Atrial Natriuretic Peptide (1 - 24), frog
SSDCFGSRIDRIGAQSGMGCGRRF (Disulfide bridge: 4 - 20)

0.5 mg

1 mg

20645

20646

Atrial Natriuretic Peptide (1 - 28), human, porcine
SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)

0.5 mg

1 mg

20647

20648

Thr - Ala - Pro - Arg - Atrial Natriuretic Peptide, Urodilatin, human
TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 11 - 27)

0.5 mg

1 mg

20649

20650

Atrial Natriuretic Peptide (1 - 28), human, porcine, Biotin - labeled
Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)

0.5 mg

1 mg

23972

23973

Atrial Natriuretic Peptide (1 - 28), human, porcine, FAM - labeled
FAM - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)

0.5 mg

61198

Atrial Natriuretic Peptide (1 - 28), human, porcine, TAMRA labeled
TAMRA - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (S - S Bonded)

1 mg

61199

Atrial Natriuretic Peptide (1 - 28), rat
SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)

0.5 mg

1 mg

20651

20652

Atrial Natriuretic Peptide (1 - 29), chicken
MMRDSGCFGRRIDRIGSLSGMGCNGSRKN (Disulfide bridge: 7 - 23)

0.5 mg

1 mg

20641

20642

Atrial Natriuretic Peptide (4 - 18), rat
RSSCFGGRIDRIGAC - NH2 (Disulfide bridge 4 - 15)

1 mg

62839

Atrial Natriuretic Peptide (4 - 24), frog
CFGSRIDRIGAQSGMGCGRRF (Disulfide bridge: 1 - 17)

0.5 mg

1 mg

20643

20644

Atrial Natriuretic Peptide (5 - 25), rat, Atriopeptin I, rat
SSCFGGRIDRIGAQSGLGCNS (Disulfide bridge: 3 - 19)

0.5 mg

1 mg

24202

24477

Atrial Natriuretic Peptide (5 - 27), Atriopeptin II, rat
SSCFGGRIDRIGAQSGLGCNSFR (Disulfide bridge: 3 - 19)

0.5 mg

1 mg

20653

20654

[Tyr0] - Atrial Natriuretic Peptide (5 - 27), [Tyr0] - Atriopeptin II, rat
YSSCFGGRIDRIGAQSGLGCNSFR (Disulfide bridge: 4 - 20)

0.5 mg

1 mg

20663

20664

[Tyr8] - Atrial Natriuretic Peptide (5 - 27), [Tyr8] - Atriopeptin II, rat
SSCYGGRIDRIGAQSGLGCNSFR (Disulfide bridge: 3 - 19)

0.5 mg

1 mg

20655

20656

Atrial Natriuretic Peptide (5 - 28), Atriopeptin III, rat
SSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 3 - 19)

0.5 mg

1 mg

20657

20658

Atrial Natriuretic Peptide Substrate, [pS6] ANF 1 - 28
SLRRS - pS - CFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge 7 - 23)

1 mg

5 mg

24518

24519


Table 2. Listing of brain natriuretic peptides (BNPs) and C-type natriuretic peptides (CNPs).

Product

Size

Catalog #

BNP (64 - 95), rat
NSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge: 10 - 26)

0.5 mg

1 mg

22930

22931

BNP (7 - 32), porcine
DSGCFGRRLDRIGSLSGLGCNVLRRY (Disulfide bridge: 4 - 20)

0.5 mg

1 mg

22928

22929

BNP - 32, human
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10 - 26)

0.5 mg

1 mg

24015

24016

BNP - 32, porcine
SPKTMRDSGCFGRRLDRIGSLSGLGCNVLRRY (Disulfide bridge: 10 - 26)

1 mg

20662

BNP - 45 (51 - 95), rat, 5K Cardiac Natriuretic Peptide
SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
(Disulfide bridge:23 - 39)

0.5 mg

61153

BNP - 45, mouse
SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL
(Disulfide bridge:23 - 39)

0.5 mg

61152

Vasonatrin Peptide (1 - 27)
GLSKGCFGLKLDRIGSMSGLGCNSFRY (Disulfide bridge: 6 - 22)

0.5 mg

1 mg

24245

24246

C - Type Natriuretic Peptide (32 - 53), human, porcine
GLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: 6 - 22)

0.5 mg

1 mg

24243

24244

Related Products

Angiotensins and Related Peptides
Renin Related Peptides
SensoLyte Renin Assay Kits (fluorimetric) & Recombinant Proteins

To inquire about custom synthesis of natriuretic peptides not listed above or for other peptides, please email service@anaspec.com.

Reference: De Bold , A. et al. Life Sci. 28, 89 (1981); Maeda, K. et al. Am. Heart J. 135, 825 (1998); Cardarelli, R. et al. J. Am. Board Fam. Prac. 16, 327 (2003); Struthers, A. BMJ 308, 1615 (1994); Levin, E. et al. N. Engl. J. Med. 339, 321 (1998); Cheung, B. et al. JAMA 280, 1983 (1998); Kalra, P. et al. Eur. Heart J. 22, 997 (2001); Ee Lemos, JA. et al. Lancet 362, 316 (2005).