Atrial Natriuretic Peptides (ANP)

AnaSpec, EGT Group provides a wide range of GO(catalog) natriuretic peptides for use in research laboratories. Our selection of atrial natriuretic peptides (ANPs) include the biologically active 1-28 amino acid peptide (human/porcine or rat sequences); shorter ANP fragments; and Biotin, FAM and TAMRA labeled human/porcine ANP (1-28). Brain natriuretic peptide (BNP) and C-type natriuretic peptide (CNP) are also available.

Wide selection of ANP peptides
ANPs human/porcine, rat, chicken sequences
ANPs biotin, FAM & TAMRA labeled peptides
BNP & CNP peptides

Natriuretic peptides are a family of naturally occurring proteins that play a major role in down-regulating the activity of the renin-angiotensin-aldosterone system; regulating circulatory homeostasis; modulating cardiovascular system, causing natriuresis and vasodilatation. There are at least three major natriuretic peptides that have been discovered: atrial natriuretic peptide (ANP)- secreted largely by the atria; brain natriuretic peptide (BNP) - produced by the ventricles and C-type natriuretic peptide (CNP)- located in peripheral blood vessels.

Table 1. Listing of atrial natriuretic peptides (ANPs).

Product

Size

Catalog #

Atrial Natriuretic Peptide (1 - 28), human, porcine
SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)

0.5 mg

1 mg

AS-20647

AS-20648

Atrial Natriuretic Peptide (1 - 28), human, porcine, Biotin - labeled
Biotin - SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)

0.5 mg

AS-23972

Atrial Natriuretic Peptide (1 - 28), rat
SLRRSSCFGGRIDRIGAQSGLGCNSFRY (Disulfide bridge: 7 - 23)

0.5 mg

1 mg

AS-20651

AS-20652

Atrial Natriuretic Peptide (4 - 18), rat
RSSCFGGRIDRIGAC - NH2 (Disulfide bridge 4 - 15)

1 mg

AS-62839


Table 2. Listing of brain natriuretic peptides (BNPs) and C-type natriuretic peptides (CNPs).

Product

Size

Catalog #

BNP - 32, human
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10 - 26)

0.5 mg

1 mg

AS-24015

AS-24016

BNP - 45 (51 - 95), rat, 5K Cardiac Natriuretic Peptide
SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF
(Disulfide bridge:23 - 39)

0.5 mg

AS-61153

BNP - 45, mouse
SQGSTLRVQQRPQNSKVTHISSCFGHKIDRIGSVSRLGCNALKLL
(Disulfide bridge:23 - 39)

0.5 mg

AS-61152

C - Type Natriuretic Peptide (32 - 53), human, porcine
GLSKGCFGLKLDRIGSMSGLGC (Disulfide bridge: 6 - 22)

1 mg

AS-24244

Related Products

Angiotensins and Related Peptides
Renin Related Peptides
SensoLyte Renin Assay Kits (fluorimetric) & Recombinant Proteins

To inquire about custom synthesis of natriuretic peptides not listed above or for other peptides, please email service@anaspec.com.

Reference: De Bold , A. et al. Life Sci. 28, 89 (1981); Maeda, K. et al. Am. Heart J. 135, 825 (1998); Cardarelli, R. et al. J. Am. Board Fam. Prac. 16, 327 (2003); Struthers, A. BMJ 308, 1615 (1994); Levin, E. et al. N. Engl. J. Med. 339, 321 (1998); Cheung, B. et al. JAMA 280, 1983 (1998); Kalra, P. et al. Eur. Heart J. 22, 997 (2001); Ee Lemos, JA. et al. Lancet 362, 316 (2005).