Alzheimer's Disease
  Beta-Amyloid Peptide Fragments

 Product Size Catalog # US$
Beta-Amyloid (1-10), Human
DAEFRHDSGY
1 mg AS-64478 $61
Beta-Amyloid (1-11), Human
DAEFRHDSGYE
1 mg AS-22819 $71
Beta-Amyloid (1-12), Human
DAEFRHDSGYEV
1 mg AS-62967 $83
Beta-Amyloid (1-13), Human
DAEFRHDSGYEVH
1 mg AS-64480 $83
Beta-Amyloid (1-15), Human
DAEFRHDSGYEVHHQ
1 mg AS-61798 $93
Beta-Amyloid (1-15)-Lys16(HiLyte™ Fluor 488), Human 0.5 mg AS-62002-05 $237
Beta-Amyloid (1-16), Human
DAEFRHDSGYEVHHQK
1 mg AS-24225 $83
Beta-Amyloid (1-16), Human
DAEFRHDSGYEVHHQK
5 mg AS-24226 $341
Beta-Amyloid (1-16)-Lys(Biotin-LC)-NH2, Human
DAEFRHDSGYEVHHQK-K(Biotin-LC)-NH2
1 mg AS-62136 $181
Beta-Amyloid (1-17), Human
DAEFRHDSGYEVHHQKL
1 mg AS-61955 $110
Beta-Amyloid (1-17)-Cys, Human
DAEFRHDSGYEVHHQKLC
1 mg AS-62473 $121
Beta-Amyloid (1-22), Human
DAEFRHDSGYEVHHQKLVFFAE
1 mg AS-62966 $181
Beta-Amyloid (1-34), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
0.5 mg AS-61799 $176
Beta-Amyloid (1-36), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
0.5 mg AS-60252-05 $264
Beta-Amyloid (1-37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
0.5 mg AS-60251-05 $264
Beta-Amyloid (1-37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
1 mg AS-60251-1 $423
Beta-Amyloid (1-38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
0.5 mg AS-24233 $154
Beta-Amyloid (1-38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
1 mg AS-24234 $275
Beta-Amyloid (1-39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
0.5 mg AS-24295 $181
Beta-Amyloid (1-39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
1 mg AS-24296 $335
Beta-Amyloid (1-9), Human
DAEFRHDSG
1 mg AS-61970 $71
Beta-Amyloid (10-20), Human
YEVHHQKLVFF
1 mg AS-25365 $61
Beta-Amyloid (10-26), Human
YEVHHQKLVFFAEDVGS
1 mg AS-62885 $105
Beta-Amyloid (10-35)-Lys(Biotin)-NH2, Human
YEVHHQKLVFFAEDVGSNKGAIIGLM-K(Biotin)-NH2
0.1 mg AS-63745 $121
Beta-Amyloid (11-17), Human
EVHHQKL
1 mg AS-63819 $71
Beta-Amyloid (11-22), Human
EVHHQKLVFFAE
1 mg AS-23956 $99
Beta-Amyloid (11-25), Human
EVHHQKLVFFAEDVG
1 mg AS-62884 $93
Beta-Amyloid (16-22), Human, mouse/rat
KLVFFAE
1 mg AS-62897 $71
Beta-Amyloid (17-24), Human, mouse/rat
LVFFAEDV
1 mg AS-61978 $71
Beta-Amyloid (22-35), Human, mouse/rat
EDVGSNKGAIIGLM
1 mg AS-22823 $115
Beta-Amyloid (25-35) • HCl, Human, mouse/rat
GSNKGAIIGLM • HCl
5 mg AS-23212 $313
Beta-Amyloid (25-35), Human, mouse/rat
GSNKGAIIGLM
1 mg AS-24227 $49
Beta-Amyloid (25-35), Human, mouse/rat
GSNKGAIIGLM
5 mg AS-24228 $193
Beta-Amyloid (25-35), HiLyte™ Fluor 488-labeled, Human, mouse/rat
HiLyte™ Fluor 488-GSNKGAIIGLM
0.1 mg AS-63308 $110
Beta-Amyloid (25-35), scrambled, Human, mouse/rat
MAKGINGISGL
1 mg AS-61971 $71
Beta-Amyloid (3-16), Human
EFRHDSGYEVHHQK
1 mg AS-64793 $77
Beta-Amyloid (40-1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
0.5 mg AS-22817 $193
Beta-Amyloid (40-1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
1 mg AS-22818 $325
Biotin-beta-Amyloid (25-35), Human, mouse/rat
Biotin-GSNKGAIIGLM
1 mg AS-62451 $105
Biotin-LC-beta-Amyloid (15-25), Human, mouse/rat
Biotin-LC-QKLVFFAEDVG
1 mg AS-62907 $115
Biotin-LC-beta-Amyloid (22-41), Human, mouse/rat
Biotin-LC-EDVGSNKGAIIGLMVGGVVI
1 mg AS-62455 $198
ClearPoint™ beta-Amyloid (1-38), 13C-Phe & Ile, Human
DAEFRHDSGYEVHHQKLV-*F-*F-AEDVGSNKGA-*I-*I-GLMVGG *F=Phe(U-13C9), *I=Ile(U-13C6)
0.05 mg AS-65220 $117
  < Back