Diabetes and Insulin Related
  Beta-Amyloid Peptide Fragments

 Product Size Catalog # US$
Beta-Amyloid (1-11), Human
DAEFRHDSGYE
1 mg AS-22819 $71
Beta-Amyloid (1-16), Human
DAEFRHDSGYEVHHQK
1 mg AS-24225 $83
Beta-Amyloid (1-16), Human
DAEFRHDSGYEVHHQK
5 mg AS-24226 $341
Beta-Amyloid (1-36), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
0.5 mg AS-60252-05 $264
Beta-Amyloid (1-37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
0.5 mg AS-60251-05 $264
Beta-Amyloid (1-37), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
1 mg AS-60251-1 $423
Beta-Amyloid (1-38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
0.5 mg AS-24233 $154
Beta-Amyloid (1-38), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGG
1 mg AS-24234 $275
Beta-Amyloid (1-39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
0.5 mg AS-24295 $181
Beta-Amyloid (1-39), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
1 mg AS-24296 $335
Beta-Amyloid (10-20), Human
YEVHHQKLVFF
1 mg AS-25365 $61
Beta-Amyloid (11-22), Human
EVHHQKLVFFAE
1 mg AS-23956 $99
Beta-Amyloid (40-1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
0.5 mg AS-22817 $193
Beta-Amyloid (40-1), Human
VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
1 mg AS-22818 $325
  < Back