HCV
  Hepatitis C Virus (HCV) Related Peptides

 Product Size Catalog # US$
HCV (Hepatitis C Virus) NS3/4A Protease Substrate
Ac-DE-Dap(QXL 520)-EE-Abu-ψ-[COO]AS-C(5-FAMsp)-NH2
1 mg AS-60798 $726
Hepatitis Virus C NS3 Protease Inhibitor 2
Ac-DE-Dif-E-Cha-C
1 mg AS-25346 $423
PEP1
SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
1 mg AS-60430-1 $291
  < Back