Microbial
  Antimicrobial and Related Peptides

 Product Size Catalog # US$
5-FAM-LC-LL-37
5-FAM-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
0.1 mg AS-63694 $132
Apidaecin IB
GNNRPVYIPQPRPPHPRL
1 mg AS-62044 $110
Biotin-LC-LL-37
Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
0.5 mg AS-63693 $291
CSP-2, Competence-Stimulating Peptide-2
EMRISRIILDFLFLRKK
1 mg AS-63877 $105
Cys-LC-LL-37
C-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
1 mg AS-63692 $291
Drosocin
GKPRPYSPRPTSHPRPIRV
1 mg AS-62600 $115
Human Lactotransferrin (37-61), Lactoferricin H
TKCFQWQRNMRKVR-G-PPVSCIKRDS (Disulfide between Cys3 and Cys20)
1 mg AS-64074 $231
Human Platelet Factor IV 18, C18G
ALYKKLLKKLLKSAKKLG
1 mg AS-62412 $110
Lactoferricin B, Lactoferrin (17-41)
FKCRRWQWRMKKLGAPSITCVRRAF (S-S BOND)
1 mg AS-62651 $198
LL-37, Antimicrobial Peptide, human
[LL-37, 37 aa]
1 mg AS-61302 $179
LL-37, reverse sequence
SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
0.5 mg AS-62208 $143
Pyrrhocoricin
VDKGSYLPRPTPPRPIYNRN
1 mg AS-62601 $121
  < Back