Neurobiology
  Neuropeptides

 Product Size Catalog # US$
LCMV NP396 H-2Db peptide
FQPQNGQFI
1 mg AS-61700 $71
Neurotensin
pE-LYENKPRRPYIL
1 mg AS-62677 $83
Secretoneurin
TNEIVEEQYTPQSLATLESVFQELGKLTGPSNQ
1 mg AS-62673 $286
  < Back