Search Results
 Product Size Catalog # US$
Autocamtide-2 [KKALRRQETVDAL]
KKALRRQETVDAL
1 mg AS-60249-1 $83
Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP)
KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
1 mg AS-64606 $220