About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics
AnaSpec News

55 New Peptides - August 28, 2007

This week AnaSpec introduced fifty-five (55) new peptides for drug discovery research.

Beta-Amyloid (1-11)-Lys (Biotin) - Cat# 62135
This is a C-terminal Lys(Biotin) modified b-Amyloid peptide; residues 1 to 11.
Sequence: DAEFRHDSGY-K(Biotin)

Beta-Amyloid (1-17)-Lys(Biotin-LC) - Cat# 62136
This is a C-terminal Lys(Biotin-LC) modified b-Amyloid peptide; residues 1 to 17. 6-aminohexanoate (LC) is used as a spacer.
Sequence: DAEFRHDSGYEVHHQK-K(BIOTIN-LC)-NH2

[Gly10;11]-beta-Amyloid (1-11) - Cat# 62138
This N-terminal fragment of b-Amyloid peptide; residues 1 to 11; has been modified with two glycines at positions 10 and 11 instead of Tyr (Y) and Glu (E).
Sequence: DAEFRHDSGGG

Beta-Amyloid (16-24) - Cat# 62139

Sequence: KLVFFAEDV

[Gly11;12] -beta-Amyloid (1-13)-Lys(Biotin) - Cat# 62134
This is the N-terminal fragment of the b-Amyloid peptide; residues 1 to 13; modified with two glycines substituted for Glu (E) and Val (V) at positions 11 and 12 and Lys(Biotin) coupled to the C-terminus.
Sequence: DAEFRHDSGYGG-K(BIOTIN)

TAT-NSF222scr Fusion Polypeptide; scrambled - Cat# 62210
This is a scrambled TAT-NSF222scr fusion polypeptide. It is composed of 11 amino acids from the cell permeable human immunodeficiency virus TAT polypeptide; 3 glycines as a linker; followed by scrambled N-Ethyl-maleimide-sensitive factor (NSF) D1 domain. This peptide is used as a control for the TAT-NSF222 peptide.
Sequence: YGRKKRRQRRR-GGG-ENSFRFLADIFPAKAFPVRFE

GLP-2 (1-34); Glucagon-ike Peptide-2 (1-34); human - Cat# 62068
Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability; and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor; a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR

C34-LC-Biotin; gp41 HIV fragment - Cat# 62103
This peptide C34; also known as HR2; belongs to the helical region of gp41 of HIV; C-terminal heptad repeat 2 (HR2) defined as C helix or C-peptide. This peptide is biotinylated through 6-aminohexanoate (LC) as a spacer. HIV-1 enters cells by membrane fusion; gp41. C-peptides are potent inhibitors of HIV-1 fusion.
Sequence: WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLK(LC-Biotin)

3;4 Dehydro-Pro-Arg-Vasotocin - Cat# 62097
This is a neurohypophyseal nonapeptide hormone showing both vasopressin- and oxytocin-like activities.
Sequence: CYIQNC(3;4-Dehydro-pro)-RG-NH2 (S-S Bond)

MBP p68–86; Myelin Basic Protein p68–86 - Cat# 62081
This is a myelin basic protein encephalitogenic epitope used to induce experimental autoimmune encephalomyelitis (EAE) in rats.
Sequence: YGSLPQKSQRSQDENPV

?-C2/V1 (49-53); ? PKC; C2 Domain (49-53) - Cat# 62175
This peptide belongs to the C2 regulatory domain of ?-protein kinase C; also known as ?-PKC/V1. This peptide; used in studying the physiological role of isozymes; is most likely the PKC-selective activator and is found to be cardioprotective.
Sequence: SRIGQ

?-C2/V1; ? PKC; C2 Domain (119-124) - Cat# 62177
This peptide belongs to the C2 regulatory domain also called VI of ?-protein kinase C (?-PKC). This ?-C2/V1 peptide may act as inhibitor of PKC translocation; this inhibitory activity results in decline of MARCKS phosphorylation.
Sequence: LEPEGK

CLP24 (187-201); Claudin-like Protein 24 (187-201); human - Cat# 62172
This peptide is a hypoxically regulated cell junction protein fragment. The claudin-like protein 24 (CLP24) contains four predicted trans-membrane domains and a C-terminal protein-protein interaction domain. These domains are characteristic of the four trans-membrane spanning family of proteins; which includes myelin protein 22. These proteins are involved in cell adhesion at tight; gap and adherens junctions. CLP24 is highly expressed in lung; heart; kidney and placental tissues.
Sequence: IWNILHKREDCMAPR

Gamma-Fibrinogen (377-395) - Cat# 62128
This fibrinogen-derived inhibitory peptide attenuates microglia activation and suppresses relapsing paralysis in multiple sclerosis (MS). Fibrinogen is a regulator of microglia activation and interaction of fibrinogen with the microglia integrin receptor Mac-1. Because blocking fibrinogen–Mac-1 interactions affects the pro-inflammatory but not the pro-coagulant properties of fibrinogen; targeting this gamma- fibrinogen epitope could represent a potential therapeutic strategy for MS and other neuroinflammatory diseases associated with blood-brain barrier disruption and microglia activation.
Sequence: YSMKETTMKIIPFNRLSIG

Gamma-Fibrinogen (377-395); scrambled - Cat# 62129
This is a scrambled sequence of the g-fibrinogen amino acids 377 to 395. The original fibrinogen-derived inhibitory peptide attenuates microglia activation and suppresses relapsing paralysis in multiple sclerosis (MS). This scrambled peptide fails to produce these functions.
Sequence: KMMISYTFPIERTGLISNK

Glu-Glu epitope Tag - Cat# 62189
This peptide is a 314 to 319 amino acids fragment of the middle T antigen of mouse polymavirus. Glu-Glu epitope peptide is widely used as an epitope tag.
Sequence: EYMPME

Pro-apoptotic Peptide; klaklakklaklak; 5/6-FAM-labeled - Cat# 62206
This is the pro-apoptotic peptide composed of D-amino acids; 5-FAM labeled. This alpha-helical amphipathic peptide is toxic to eukaryotic cells if internalized by a suitable targeting mechanism. It disrupts mitochondrial membranes upon receptor-mediated cell internalization and causes programmed cell death.
Sequence: 5-FAM-klaklakklaklak-NH2

Beta-Amyloid (1-17) - Cat# 61955
This is beta-Amyloid peptide fragment derived from amino acids 1 to 17. This peptide was employed in the b-Amyloid solubility studies.
Sequence: DAEFRHDSGYEVHHQKL

Beta-Amyloid (1-9) - Cat# 61970
This is the N-terminal fragment of b-Amyloid peptide amino acids 1 to 9. Omission of residues 1 to 9 from the full-length Alzheimer's b-Amyloid peptide 1 to 40 does not prevent the peptide from forming amyloid fibrils or eliminate fibril polymorphism. This b-Amyloid peptide fragment contains a functional B cell epitope; but lacks known T cell epitopes; which makes it an attractive candidate for the development of b-Amyloid vaccine that lacks the potential to induce autoimmune encephalitis.
Sequence: DAEFRHDSG

Beta-Amyloid (25-35); Scrambled - Cat# 61971
This is the scrambled beta-Amyloid peptide amino acids 25 to 35. Pairing this peptide with the native b-Amyloid 25 to 35 amino acids peptide has been used to recognize its structure and functions.
Sequence: MAKGINGISGL

Beta-Amyloid (22-42) - Cat# 61972
This is the hydrophobic C-terminal fragment of b-Amyloid peptide amino acids 22 to 42.
Sequence: EDVGSNKGAIIGLMVGGVVIA

Beta-Amyloid (1-9)-Lys(Biotin-LC)-NH2 - Cat# 61973
This is an N-terminal modified fragment of the b-Amyloid 1 to 9; with the addition of a lysine and a biotin conjugated to a spacer; 6-aminohexanoate (LC).
Sequence: DAEFRHDSG-K(Biotin-LC)-NH2

Beta-Amyloid (8-40) - Cat# 61975
This peptide is b-Amyloid 8 to 40 amino acids fragment. Angiotensin-converting enzyme (ACE) genotype has been shown to be associated with Alzheimer's disease (AD) in some populations. ACE degrades b-Amyloid by cleaving ß-?Amyloid 1 to 40 between Asp7-Ser8. Compared with b-Amyloid 1 to 40; aggregation and cytotoxic effects of the degradation products b-Amyloid 1 to 7 and b-Amyloid 8 to 40 peptides are reduced or virtually absent.
Sequence: SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Beta-Amyloid (30–34) - Cat# 61977
This peptide is beta-Amyloid 30 to 34 amino acids fragment. The structural fluctuations of amyloid peptides were analyzed for the presence of flickering of alpha-like and ß-like structure. The flickering of alpha-helical structure was apparent in the AIIGL (30–34) region. This peptide has a strong helical propensity.
Sequence: AIIGL

Beta-Amyloid (17–24) - Cat# 61978
This peptide is b-Amyloid 17 to 24 amino acids fragment. Several lines of evidence indicate that a region centering around positions 17 to 20 amino acids is important for b-Amyloid fibril formation. Destabilization of a helix covering residues 11–24; in particular residues 17–24; is critical for alpha-helix to b-strand conversion and fibril formation.
Sequence: LVFFAEDV

[Cys3]-beta-Amyloid (4-10) - Cat# 61979
This peptide is b-Amyloid 4 to 10 amino acids fragment. b-Amyloid (4-10) is the predominant B-cell epitope recognized by therapeutically active antisera from transgenic Alzheimer's disease mice. Cysteine residue is added for the use in antibody development.
Sequence: CFRHDSGY

Beta-Amyloid (35-42) - Cat# 61981
This synthetic peptide corresponding to amino acids 35 to 42 of b-Amyloid protein; is widely used as an immunogen for the development of the anti- b-Amyloid antibodies.
Sequence: MVGGVVIA

Beta-Amyloid (33-40) - Cat# 61982
This is a synthetic peptide fragment corresponding to amino acids 18 to 25 of b-Amyloid; and amino acid residues 704 to 711 of amyloid precursor protein (APP). This peptide is widely used as an immunogen for anti- b-Amyloidantibodies development.
Sequence: GLMVGGVV

Amyloid Precursor Protein (APP) (44-62) - Cat# 61983
This is a synthetic peptide corresponding to N terminal amino acids 44 to 62 of human amyloid precursor protein (APP).
Sequence: HMNVQNGKWDSDPSGTKTC

[Phe34]-beta-Amyloid (25-35) - Cat# 61984
This is a modified fragment of the b-Amyloid peptide amino acids 25 to 35 with leucine at the position 34 replaced by phenylalanine.
Sequence: GSNKGAIIGFM

Beta-Amyloid (26-40) - Cat# 61985
This is a fragment of the b-Amyloid peptide amino acid residues 26 to 40; the same sequence belongs to the amyloid precursor protein695 (APP695) amino acids 622 to 637; a linear peptide which contains the GVV terminal sequence of ß-?Amyloid (1–40).
Sequence: SNKGAIIGLMVGGVV

Beta-Amyloid (20-42) - Cat# 61989
This synthetic peptide corresponds to amino acids 20 to 42 of b-Amyloid protein.
Sequence: FAEDVGSNKGAIIGLMVGGVVIA

[Met-1;Leu35]-beta-Amyloid (1-42) - Cat# 61957-01
This is the beta-Amyloid peptide amino acid residues 1 to 42 modification. Methionine is coupled to the N-terminus at position-1; and leucine replaces methionine at position 35.
Sequence: MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLLVGGVVIA

Beta-Amyloid (17-24); biotinylated - Cat# 61980
This is a biotinylated form of b-Amyloid (17-24). The synthetic peptide corresponding to amino acids 17 to 24 of b-Amyloid protein is the putative sequence responsible for hepatic b-Amyloid 1 to 40 uptake by the liver; which plays a major role in the systemic clearance of b-Amyloid 1 to 40.
Sequence: BIOTIN-LVFFAEDV

Nociceptin (1-13); amide - Cat# 61950-5
This 1 to 13 amino acid fragment of the nociceptin agonist is the smallest peptide with the potency of the natural nociceptin protein. Nociceptin is related to opioid peptides.
Sequence: FGGFTGARKSARK

M2 (127-135); Respiratory Syncytial Virus (RSV)-specific peptide (127-135) - Cat# 62021
This is an optimal nine-amino-acid 127 to 135 peptide respiratory syncytial virus (RSV)-specific; the H-2Kd-restricted subdominant epitope in the M2 protein; which contains an H-2Kd consensus sequence with Y at position 2 and I at position 9. The M2 gene is unique to the genus Pneumovirus. It has two overlapping open reading frames; M2-1 and M2-2; both involved in the viral RNA synthesis process.
Sequence: VYNTVISYI

NPSF (1-37); Neuropeptide SF (1-37) - Cat# 62016
This sequence is a mature Neuropeptide SF (NPSF) peptide derived from the neuropeptide precursor. NPFF gene encodes for three peptides: NPFF; NPAF; and NPSF. This peptide belongs to the family of neuropeptides that function as neurotransmitters and neuromodulators.
Sequence: SLNFEELKDWGPKNVIKMSTPAVNKMPHSFANLPLRF-NH2

NPVF - Cat# 62006
This sequence is a neuropeptide encoded by the NPVF gene. The NPVF-is the endogenous ligand for FF1 receptor. NPVF mRNA was detected specifically in a region between the dorsomedial and ventromedial hypothalamic nuclei. Following intracerebral administration; NPVF-derived peptide blocks morphine-induced analgesia in both acute and inflammatory models of pain. The NPVF/FF1 system may be an important part of endogenous anti-opioid mechanism.
Sequence: VPNLPQRF-NH2

TIF2 (740-753); Transcriptional Intermediary Factor 2 (740-753) - Cat# 61992
This peptide is a nuclear receptor (NR) box B3 region of the p160 co-activator Transcriptional Intermediary Factor 2 (TIF2) peptide; a LXXLL motif. The activation function 2/ligand-dependent interaction between nuclear receptors and their co-regulators is mediated by a short consensus motif nuclear receptor box.
Sequence: KENALLRYLLDKDD

RIP (817-828); Receptor Interacting Protein (817-828) - Cat# 61996
This sequence corresponds to the LXXLL motif derived from the 140 kDa Receptor Interacting Protein (RIP140) amino acids 498 to 509. LXXLL motif is a signature sequence that facilitates the interaction of different proteins with nuclear receptors.
Sequence: GLLSRLLRQNQD

SRC 1 (1433-1441); Steroid Receptor Co-activator 1 (1433-1441) - Cat# 61999
This short sequence present in Steroid Receptor Co-activator 1 (SRC1) is necessary and sufficient to mediate the binding of the protein to liganded nuclear receptors. An alpha-helical motif containing the sequence LXXLL (where L is leucine and X is any amino acid) is required for the ligand-dependent binding of transcriptional co-activators to nuclear receptors.
Sequence: SLLQQLLTE

TIF2 (682-700) box 2; Transcriptional Intermediary Factor 2 (682-700); Box2 - Cat# 62000
This is a Nuclear Receptor (NR)-box peptide 2; also known as Transcriptional Intermediary Factor 2 (TIF2) box 2; amino acids 682 to 700; the potent competitor of the TR LBD (Thyroid Hormone Ligand Binding Domain ) / NID3 (NR Interaction Domain) interaction; it is also sufficient to interact with TR-beta LBD.
Sequence: TSLKEKHKILHRLLQDSS

TIF2 (636-649); Transcriptional Intermediary Factor 2 (636-649); Box1 - Cat# 61993
This is LXXLL motif Box B1 of the Transcriptional Intermediary Factor 2 (TIF2) peptide; amino acids 636 to 649. The interaction studies between estrogen receptor (ER alpha ) and the nuclear receptor (NR) box regions of the p160 coactivator TIF2 showed that C-terminal ligand-binding domain (LBD) of ER binds LXXLL motifs (Box B1 and B3) and exhibits different binding kinetics compared with the Box B2 motif.
Sequence: KGQTKLLQLLTTKS

RIP (131-142); Receptor Interacting Protein (131-142). - Cat# 61995
This sequence corresponds to the LXXLL motif derived from the 140 kDa Receptor Interacting Protein (RIP140); amino acids 131 to 142. Ligand-dependent gene expression mediated by nuclear receptors involves the recruitment of transcriptional co-activator to the ligand binding domain (LBD). This motif shows strong binding to LBD.
Sequence: TLLASLLQSESS

RIP (498-509); Receptor Interacting Protein (498-509) - Cat# 61997
This sequence corresponds to the LXXLL motif derived from the 140kDa Receptor Interacting Protein (RIP140); amino acids 498 to 509.
Sequence: TLLQLLLGHKNE

SRC 1 (1433-1440); Steroid Receptor Co-activator (1433-1440) - Cat# 61998
This short sequence corresponding to the motif LXXLL (where L is leucine and X is any amino acid) of Steroid Receptor Co-activator (SRC1) is necessary and sufficient to mediate the binding of this protein to liganded nuclear receptor.
Sequence: SLLQQLLT

105Y; alpha1-antitrypsin (359-374) - Cat# 62004
This peptide representing the sequence of a candidate receptor-binding domain in the carboxyl-terminal tail of alpha1-antitrypsin (a1-AT) was shown to mediate increases in synthesis of alpha1-AT in human monocytes and human hepatoma HepG2 cells. The serpin-enzyme complex (SEC) receptor was originally identified using this peptide; 105Y.
Sequence: SIPPEVKFNKPFVYLI

EGFR (662-681) - Cat# 62013
This peptide belongs to epidermal growth factor receptor; (EGFR); amino acids 662 to 681. The epidermal growth factor receptor is a member of the ErbB family of receptors. This peptide was used in several assays; including determination of the p42/44 (ERK) MAP kinases activity.
Sequence: RRELVEPLTPSGEAPNQALLR

Hemoglobin; 3037a; Malaria FRET Substrate II - Cat# 62014
The sequence of this peptide is based on the primary site of cleavage within hemoglobin (Hb). The numbering of the peptide corresponds to the residues within the alpha-chain of Hb. This peptide was used to characterize the molecular mechanism underlying Hb degradation by plasmepsin II (PM II). N-terminal (GABA) extension results in higher maximal velocity and dramatic concentration-dependent substrate inhibition. Hb is degraded in the protozoan parasite Plasmodium falciparum. Of the four types of malaria infecting humans; the most severe form is caused by P. falciparum.
Sequence: DABCYL-GABA-ERMFLSFP-EDANS

Hemoglobin; 2837a; Malaria FRET substrate III - Cat# 62015
The sequence of this synthetic peptide is based on the primary site of cleavage within hemoglobin (Hb). The numbering of the peptide corresponds to the residues within the alpha-chain of Hb. Hb is degraded in the protozoan parasite Plasmodium falciparum. Of the four types of malaria infecting humans; the most severe form is caused by P. falciparum. To mature inside erythrocytes; parasites degrade vast amounts of Hb in an enormous catabolic effort. Plasmepsin II (PM II) is an aspartic protease that cleaves hemoglobin in the protozoan parasite P. falciparum. N-terminal (GABA) extension results in higher maximal velocity and dramatic concentration-dependent substrate inhibition.
Sequence: DABCYL-GABA-ALERMFLSFP-EDANS

PKC zeta 560 - Cat# 62020
This protein kinase C (PKC) zeta isoform contains the threonine 560 autophosphorylation site. The full activation of PKC-zeta by insulin in addition to other factors requires phosphatidylinosito (PIP3)- dependent enhancement of autophosphorylation of threonine 560.
Sequence: EPVQLTPDDEDA

Microtubule-associated Protein 7; MAP7; mouse (CT) - Cat# 61952
This peptide is a C-terminal fragment of microtubule-associated protein 7 (MAP7); the mouse transient receptor potential vanilloid 4 (TRPV4) C-terminal binding protein analog; and a member of the transient receptor potential family of ligand-gated ion channels. TRPV4 and MAP7 co-localize in the lung and kidney.
Sequence: TQQTAEVI

Microtubule-associated Protein 7 (MAP7); mouse (NT) - Cat# 61953
This peptide is N-terminal fragment of microtubule-associated protein 7 (MAP7); the mouse Transient Receptor Potential Vanilloid 4 (TRPV4) C-terminal binding protein analog; and a member of the TRPV family of ligand-gated ion channels.
Sequence: MDQAKSAE

Aquaporin 2 (241-271); AQP2 (241-271) - Cat# 62007
This sequence belongs to the aquaporin 2 (AQP2) residues 241 to 271. It is a vasopressin-regulated water channel. Studies reveal a reciprocal change in Ser256 and Ser261 phosphorylation in response to short-term vasopressin exposure; suggesting that these residues may serve distinct roles in regulation of AQP2 subcellular distribution and collecting duct water permeability.
Sequence: EPDTDWEEREVRRRQSVELHSPQSLPRGSKA

MKK4 Docking Site peptide - Cat# 62001
This sequence is a minimal MKK4 docking site; or 'D-site' peptide. MAPK-docking site is in the N terminus of human MKK4/JNKK1. This docking site is necessary for the high affinity binding of the MAPKs JNK1; JNK2; JNK3; p38-alpha; and p38-beta to MKK4. Specific docking interactions between MAPKs and their activating MAPK kinases (MKKs or MEKs) are crucial for efficient and accurate signal transmission.
Sequence: QGKRKALKLNF

  < Back