About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics
AnaSpec News

Nine New Peptides - September 19, 2007

This week AnaSpec introduced nine (9) new peptides for drug discovery research.

Rat Renin FRET Substrate (5-FAM/QXL™520) - Cat# 62334
This renin FRET peptide is a specific substrate for rat renin. Aspartyl protease cleaves angiotensinogen to yield angiotensin I; which is further converted to angiotensin II. The renin-angiotensin system is a coordinated hormonal cascade in the control of cardiovascular; renal; and adrenal function. It governs body fluid and electrolyte balance; as well as arterial pressure. Since an overactive renin-angiotensin system leads to hypertension; renin is an attractive target for the treatment of this disease. This renin peptide substrate may be used for screening renin inhibitors. In the FRET peptide; the fluorescence of 5-FAM is quenched by QXL™ 520. Upon cleavage into two separate fragments by rat renin; the fluorescence of 5-FAM is recovered; and can be monitored at excitation/emission = 490/520 nm. The SensoLyte™ 520 Renin Assay Kit (cat # 72040) contains the human renin FRET substrate.

Peptide Substrate for Renin 520 Assay kit - Cat# 61872-01
This FRET peptide is a specific substrate for renin. Aspartyl protease cleaves angiotensinogen to yield angiotensin I; which is further converted to angiotensin II. The renin-angiotensin system is a coordinated hormonal cascade in the control of cardiovascular; renal; and adrenal function. It governs body fluid and electrolyte balance; as well as arterial pressure. Since an overactive renin-angiotensin system leads to hypertension; renin is an attractive target for the treatment of this disease. This renin peptide substrate may be used for screening of renin inhibitors. In the FRET peptide; the fluorescence of 5-FAM is quenched by QXL™ 520. Upon cleavage into two separate fragments by renin; the fluorescence of 5-FAM is recovered; and can be monitored at excitation/emission = 490/520 nm. This substrate is employed in the SensoLyte™ 520 Renin Assay Kit; cat # 72040.

Rat Renin FRET Substrate (5-FAM/QXL™520) - Cat# 62334-01
This renin FRET peptide is a specific substrate for rat renin. Aspartyl protease cleaves angiotensinogen to yield angiotensin I; which is further converted to angiotensin II. The renin-angiotensin system is a coordinated hormonal cascade in the control of cardiovascular; renal; and adrenal function. It governs body fluid and electrolyte balance; as well as arterial pressure. Since an overactive renin-angiotensin system leads to hypertension; renin is an attractive target for the treatment of this disease. This renin peptide substrate may be used for screening renin inhibitors. In the FRET peptide; the fluorescence of 5-FAM is quenched by QXL™ 520. Upon cleavage into two separate fragments by rat renin; the fluorescence of 5-FAM is recovered; and can be monitored at excitation/emission = 490/520 nm. The SensoLyte™ 520 Renin Assay Kit (cat # 72040) contains the human renin FRET substrate.

[Glu1]-Fibrinopeptide B - Cat# 60501-1

Sequence: EGVNDNEEGFFSAR

Cyclo[-RGDyK(HiLyte Fluor™ 750)-] - Cat# 62333-1

Sequence: Cyclo[-RGDy-K(Hilyte Fluor 750)-]

Cyclo[-RGDyK(HiLyte Fluor™ 750)-] - Cat# 62333-01

Sequence: Cyclo[-RGDy-K(Hilyte Fluor 750)-]

Beta-Amyloid (1-42); Scrambled; 5-FAM labeled - Cat# 60892

Sequence: 5-FAM-AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA

BPE-Conjugated-beta-Amyloid(1-40) - Cat# 60496

Sequence: B-Phycoerythrin-Conjugated-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

MAPS; Core; 8-Branch - Cat# 21006

Sequence: K4K2KA-NH2

  < Back