|
50 New Peptides & 1 New Fluorescent Dye - April 17, 2008
This week AnaSpec, a world leader in integrated proteomics solutions, introduced fifty (50) new catalog peptides and one (1) new fluorescent dye.
Hylambatin - Cat# 62792
Hylambatin belongs to the tachykinins. Hylambatin was isolated from Kassina maculata (African rhacophorid frog; Hylambates maculatus) and is expressed in skin glands. It is an amphibian defense peptide.
Sequence: DPPDPDRFYGMM-NH2
[Lys6]-Eledoisin (6-11) - Cat# 62627
This amino acids 6 to 11 fragment of eledoisin with Ala6 substituted by Lys6 is a peptide of mollusk origin. It is a member of the tachykinin family of neuropeptides. Eledoisin was first isolated from the posterior salivary glands of two mollusk species Eledone muschata and E. aldovandi. All tachykinin peptides; including eledoisin; share the same consensus C-terminal sequence Phe-Xxx-Gly-Leu-Met-NH2. These peptides exhibit a wide and complex spectrum of pharmacological and physiological activities such as powerful vasodilation; hypertensive action; and stimulation of extravascular smooth muscle.
Sequence: KFIGLM-NH2
Ranatachykinin C - Cat# 62778
This ranatachykinin C peptide was isolated from the frog (Rana catesbeiana) brain and intestine. It exhibits potent stimulant effect on smooth muscle preparation of guinea pig ileum. This is one of four known ranatachykinin peptides. Ranatachykinins A; B and C have the conserved C-terminal sequence; Phe- X- Gly- Leu- Met-NH2; a sequence common to known members of the tachykinin family.
Sequence: HNPASFIGLM-NH2
Ranatachykinin B - Cat# 62777
This ranatachykinin B peptide was isolated from the frog (Rana catesbeiana) brain and intestine. It exhibits potent stimulant effect on smooth muscle preparation of guinea pig ileum. This is one of four ranatachykinin peptides. Ranatachykinins A; B and C have the conserved C-terminal sequence; Phe- X- Gly- Leu- Met-NH2; a sequence common to known members of the tachykinin family.
Sequence: YKSDSFYGLM-NH2
Histone H4 (1-7); N-Terminal - Cat# 62754
This is amino acids 1 to 7 fragment of the histone H3. Alterations in chromatin structure; such as nucleosome sliding; removal of nucleosomes; and disruption of DNA–histone or histone–histone contacts through post-translational modification of the histones; have been linked to transcriptional regulation; DNA damage repair; and replication; among other cellular processes. Modification of histones occurs primarily in the N-terminal residues or tail region. These modifications include phosphorylation; ubiquitinylation; methylation; sumolyation; and acetylation. Lys5 may serve as the acetylation site for this peptide.
Sequence: SGRGKGG
AMARA peptide - Cat# 62596
AMARA peptide is a minimal substrate for several members of the protein kinases family. It contains the phosphorylation site for AMP-activated Protein Kinase (AMPK). AMARA peptide may be employed in the applications to measure AMPK-related kinase activity.
Sequence: AMARAASAAALARRR
Catestatin; human - Cat# 62513
Catestatin is amino acids 352 to 372 fragment of chromogranin A . Chromogranin A is the endogenous compound that is able to inhibit catecholamine release elicited by the activation of neuronal nicotinic acetylcholine receptors (nAChRs). nAChRs are found in different animal species and catecholaminergic cell types.
Sequence: SSMKLSFRARAYGFRGPGPL
Valorphin - Cat# 62789
Valorphin is an opioid-like fragment of hemoglobin b-chain. Valorphin was isolated from bovine hypothalamic tissue. It possesses some opiate activity.
Sequence: VVYPWTQ
LVV-Hemorphin-6; Leu-Valorphin-Arg - Cat# 62790
This peptide is amino acids 32 to 40 fragment of the beta-; delta-; gamma; and sigma-chains of human hemoglobin. It possesses some opiate activity. This peptide was isolated from the pituitary gland.
Sequence: LVVYPWTQR
MOG (101-120); human; mouse - Cat# 62370
This is amino acids 101 to 120 fragment of myelin oligodendrocyte glycoprotein (MOG); one of the major MOG B-cell epitopes in transgenic mice. MOG is a potential target antigen of the central nervous system known to induce autoreactive T cell response and demyelinating anti-MOG antibodies in multiple sclerosis (MS) patients. Studies demonstrated that a quantitatively minor myelin protein; MOG; is also strongly encephalogenic in mice; rats; marmosets; and rhesus monkeys; which is highly relevant to MS.
Sequence: RDHSYQEEAAMELKVEDPFY
Pevpyrokinin-2 (PPK-2; Pev-PK 2) - Cat# 62775
This pevpyrokinin-2 (PPK-2; Pev-PK 2) peptide belongs to the pyrokinin neuropeptides and was isolated from white shrimp. Extract of 3500 central nervous systems of female white shrimp Penaeus vannamei was screened for myotropic activity in order to purify pyrokinin-like peptides that belong to the pyrokinin/PBAN neuropeptide family. Members of this family regulate reproductive processes in insects; including pheromone biosynthesis. The crustacean pyrokinins are the first to be found in a non insect. PK peptides share the conserved C-terminal pentapeptide sequence FXPRLamide; where X is a variable amino acid
Sequence: ADFAFSPRL-NH2
Pevpyrokinin-1 (PPK-1; Pev-PK 1) - Cat# 62774
This pevpyrokinin-1 peptide was isolated from the central nervous systems of female white shrimp; Penaeus vannamei. Pev-PK 1 contains the typical FXPRL-NH2 (X = G; S; T or V) C-terminal sequence that characterizes members of the versatile pyrokinin/PBAN family These crustacean pyrokinins are the first to be found in a noninsect. Pev-PK 1 and Pev-PK 2 synthetic peptides display myotropic activity on the Leucophaea maderae as well as on the Astacus leptodactylus hindgut.
Sequence: DFAFSPRL-NH2
Myomodulin - Cat# 62796
Myomodulin is a bioactive neuropeptide found in Aplysia neurons. It produces a hyperpolarization in several Achatina neuron types.
Sequence: PMSMLRL-NH2
Leucokinin 3 - Cat# 62799
Leucokinin-3 is an insect neuropeptide derived from Leucophaea maderae. This peptide stimulates contractile activity of cockroach protodeum (hindgut).
Sequence: DQGFNSWG-NH2
Secretogranin I Precursor (585-594) - Cat# 62662
This peptide is amino acids 585 to 594 fragment of the secretogranin I precursor. The same sequence belongs to the mature peptide; chromogranin B; parathyroid secretory protein in rat.
Sequence: SFAKAPHLDL
Pituitary Adenylate Cyclase-Activating Polypeptide Precursor (111-128) - Cat# 62675
This is amino acids 111 to 128 fragment of the pituitary adenylate cyclase-activating polypeptide precursor; also known as PACA_RAT 111.
Sequence: GMGENLAAAAVDDRAPLT
Gonadoliberin I (24-33) - Cat# 62671
This is amino acids 24 to 33 fragment of gonadoliberin 1; or gonadotropin-releasing hormone I (GnRH I). It is identical in mouse; rat; human; sheep; cow; pig; etc. The hypothalamic-pituitary GnRH system is composed of GnRH-I decapeptide hormone; and type I GnRH receptors which are involved in the regulation of gonadotrophin secretion from the anterior pituitary gland.
Sequence: QHWSYGLRPG
Delta-Sleep-Inducing Peptide (DSIP) - Cat# 62787
This delta-sleep-inducing peptide (DSIP) was isolated from rabbits. It induces slow-wave (delta) and spindles electroencephalogram enhancement after intraventricular (brain) infusion.
Sequence: WAGGDASGE
CART Protein Precursor (82-86) - Cat# 62707
This is amino acids 82 to 86 fragment of the cocaine- and amphetamine-regulated transcript (CART) Protein Precursor; or amino acids 55 to 59 fragment of CART. This is a section of the rat long form (rl) CART 55-102 bioactive peptide that opposes the actions of cocaine.
Sequence: IPIYE
alpha-Neo-Endorphin - Cat# 62678
Alpha-Neo-Endorphin(alpha-NE) is a cleavage product of the prodynorphin. Alpha-NE has been isolated from all vertebrates phyla; and from different tetrapods where it shows similar biochemical properties; reflecting the great conservation of this peptide in tetrapods.
Sequence: YGGFLRKYPK
Ecdysis-Triggering Hormone 1 (ETH1); Drosophila - Cat# 62801
This peptide is an insect ecdysis-triggering hormone (ETH). Inka cells from the epitracheal glands produce hormones that are involved in regulation of insect ecdysis. Injection of ETH is sufficient to elicit the entire ecdysis behavior.
Sequence: DDSSPGFFLKITKNVPRL-NH2
Preptin; Human Pro-Insulin Growth Factor II (69-80); mouse - Cat# 62431
This peptide belongs to the mouse preptin. Preptin is a recently isolated 34-amino acid peptide hormone that is co-secreted with insulin and amylin from the pancreatic beta-cells. Preptin corresponds to Asp69-Leu102 of pro-insulin growth factor II (pro-IGF-II). Increased circulating levels of a pro-IGF-II peptide complexed with IGF-binding protein-2 have been implicated in the high bone mass phenotype observed in patients with chronic hepatitis C infection.
Sequence: DVSTSQAVLPDDFPRYPVGKFFQYDTWRQSAGRL
MOG (92–106) - Cat# 62732
This is amino acids 92 to 106 fragment of the myelin oligodendrocyte glycoprotein (MOG). Mice with MOG (92–106)-induced experimental autoimmune encephalomyelitis develop extensive B cell reactivity against secondary myelin antigens. Despite the fact that this MOG peptide induces only weak T cell responses; MOG-induced autoimmunity is very severe. This peptide is encephalitogenic in SJL mice; DA rats; and rhesus monkeys.
Sequence: DEGGYTCFFRDHSYQ
P2 p57–81; Peripheral Myelin P2 Protein p57–81 - Cat# 62083
This peptide was used to study the experimental autoimmune encephalomyelitis (EAE) and induction of transferred EAE in mice. It is a neurotogenic peptide of P2 peripheral myelin.
Sequence: FKNTEISKLGQEFEETTADNRKTK
MBP (79-87) - Cat# 62733
This is an amino acids 79 to 87 fragment of the myelin basic protein (MBP). Injection of this peptide induces a high avidity T cell repertoire in shiverer mice that primarily consisted of clones capable of recognizing the native MBP protein; in addition to the peptide itself. Endogenous MBP is not required for the positive selection of an MBP-specific T cell repertoire. C3H mice; in contrast; are selectively unresponsive to the MBP protein and injection of this MBP peptide induces a low avidity repertoire that could be stimulated only by the peptide; not by the protein.
Sequence: DENPVVHFF
NY-ESO-1 (87-111) - Cat# 62655
This is amino acids 81 to 111 fragment of the NY-ESO-1. The NY-ESO-1 antigen is expressed by many tumors of different histological types (including breast; prostate; lung; and melanoma) and by male germline cells; but not by other normal tissues. NY-ESO-1 encodes MHC class I- and class II-restricted peptides expressed by a diverse range of cancers and recognized by T cells. This peptide is pan-MHC class II-restricted sequence that is capable of binding to multiple HLA-DR and HLA-DP4 molecules; including HLA-DRB1*0101; 0401; 0701; and 1101 and HLA-DPB1*0401 and 0402 molecules.
Sequence: LLEFYLAMPFATPMEAELARRSLAQ
BDC2.5 mimotope 1040-51 - Cat# 62755
This is a strongly agonistic peptide (mimotope) for diabetogenic T cell clone BDC2.5. from non-obese diabetic (NOD) mice. T cells from prediabetic and diabetic NODs respond to BDC2.5 mimotope peptides. This peptide is important in autoimmune diabetes research.
Sequence: RVLPLWVRME
BDC2.5 mimotope 1040-31 - Cat# 62756
This is a strongly agonistic peptide (mimotope) for diabetogenic T cell clone BDC2.5. It can stimulate BDC2.5 cells with cells showing good response to this mimotope. 1040-31 peptide is specific for BDC2.5 TCR Tg+ (transgenic) T cells. This peptide is also known as p31.
Sequence: YVRPLWVRME
MMK-1; amide - Cat# 62520
This is a formyl peptide receptor like 1 (FPRL1 ) antagonist peptide. MMK-1 was reported to mobilize Ca2+ via lipoxin A4 receptors (ALXRs); and to stimulate human polymorphonuclear leukocyte chemotaxis.
Sequence: LESIFRSLLFRVM-NH2
Dyrktide; TAMRA labeled - Cat# 62715
Dyrktide is designed as the optimal substrate sequence that is efficiently phosphorylated by DYRK1A. DYRK1A is a dual-specificity protein kinase that is thought to be involved in brain development. This peptide is labeled with TAMRA at the N-terminus; Abs/Em = 544 nm/ 572 nm..
Sequence: 5-TAMRA-RRRFRPASPLRGPPK
Autoimmune Lupus Erythematosus Epitope 1 - Cat# 62726
This small nuclear ribonucleoprotein Sm autoantigen B/B'-derived octapeptide is recognized by lupus erythematosus auto-antibodies. Autoantibodies binding the Sm B and Sm B/B? peptides are commonly associated with systemic lupus erythematosus in man and in MRLlpr/lpr mice. This region of Sm B/B? is a major area of antigenicity in human sera.
Sequence: PPPGIRGP
Heparin-Binding Peptide V; scrambled - Cat# 62705
This is a scrambled sequence of the heparin-binding peptide V which is derived from the III14 repeat of heparin-binding fibronectin fragment (HBFN-f). HBFN-f stimulates NO production in a dose-dependent manner. Peptide V with heparin-binding ability significantly reduces NO levels elevated by HBFN-f.
Sequence: RPQIPWAR
Orphanin FQ2; (OFQ2; NOCII) - Cat# 62609
Orphanin FQ2 (OFQ2); or NOCII; is a heptadecapeptide generated from prepronociceptin (PPNOC); the same precursor as for nociceptin/orphanin FQ and nocistatin. NOCII is a potent analgesic when administered both supraspinally and spinally. Intracerebroventricular administration of NOCII increases locomotion in mice. NOCII is a peptide whose sequence lies immediately downstream of nociceptin; the natural agonist of the ORL1 receptor. The sequence of NOCII is framed by putative convertase excision sites; and is totally conserved across murine and human species.
Sequence: FSEFMRQYLVLSMQSSQ
BQ123; Cyclo(-wdPvL-); Endothelin Antagonist - Cat# 62357
This peptide is a selective endothelin antagonist; a part of the Ca2+ metabolism. BQ-123 is a non-competitive antagonist of the actions of endothelin-1 in SK-N-MC human neuroblastoma cells.
Sequence: Cyclo(-wdPvL-)
Deltorphin B - Cat# 62683
Deltorphin B (or Deltorphin II) was first isolated from the skin of Phyllomedusa bicolor.
Sequence: YaFEVVG-NH2
Deltorphin C - Cat# 62681
Deltorphin C; also known as deltorphin 1 is delta-opioid receptor agonist.
Sequence: YaFDVVG-NH2
Dynorphin B (1-9) - Cat# 62687
This is amino acids 1 to 9 fragment of the dynorphin B.
Sequence: YGGFLRRQF
Dynorphin B (1-13) - Cat# 62686
This is amino acids 1 to 13 fragment of the dynorphin B; also known as Rimorphin Rimorphin is generated from dynorphin B-29 (leumorphin) by the cleavage at a single Arg residue. Rimorphin has been purified from extracts of bovine posterior pituitary glands. This unique peptide is a major [Leu]-enkephalin-containing peptide in all tissues examined that contain dynorphin and alpha-neo-endorphin. A rat brain membrane extract was also shown to convert synthetic dynorphin B-29 to rimorphin.
Sequence: YGGFLRRQFKVVT
Dermorphin - Cat# 62684
This peptide is ?-opioid receptor agonist
Sequence: YaFGYPS
Lipid Membrane Translocating Peptide; D-isomer - Cat# 62398
This is an all d-amino acids sequence of the lipid membrane translocating peptide. It is a drug delivery peptide that is able to penetrate the lipid membranes.
Sequence: kkaaavllpvllaap
Survivin 2B (80–88) - Cat# 62693
This peptide is amino acids 80 to 88 fragment of survivin-2B. It is capable of binding to HLA-A24. This peptide is a potent T-cell epitope eliciting CTL response against a splicing variant survivin-2B; which is specifically expressed in many kinds of cancer cells.
Sequence: AYACNTSTL
Tyrosinase (240-251) - Cat# 62711
This is amino acids 240 to 251 fragment of tyrosinase; the HLA-A1-restricted epitope. This peptide is a incredibly immunogenic epitope used in melanoma vaccines studies.
Sequence: DAEKSDICTDEY
MAGE-A 1(96–104) - Cat# 62709
This is amino acids 96 to 191 fragment of the MAGE-A1. This peptide is immunogenic when administered to patients with stage IIB; III; or IV melanoma. It is considered for inclusion in vaccines against cancers of many histologic types; in addition to melanoma.
Sequence: SLFRAVITK
Metalnikowin IIA - Cat# 62602
Metalnikowin IIA is an antibacterial peptide active against Gram-negative bacteria.
Sequence: VDKPDYRPRPWPRPN
Drosocin - Cat# 62600
Drosocin is a 19-mer cationic antimicrobial peptide from Drosophila melanogaster. In Drosophila native drosocin carries a disaccharide moiety attached to a threonine residue in mid-chain position. This synthetic drosocin peptide of identical amino acid sequence without the disaccharide has an activity several times lower than the native compound.
Sequence: GKPRPYSPRPTSHPRPIRV
HspB8 (184-196); human - Cat# 62592
This is amino acids 184 to 196 fragment of the heat shock protein HspB8. The C-terminal domain of HspB8 is necessary for chaperone activity. HspB8 is highly expressed in the neuronal tissue; heart; brain. It was shown to affect on beta-amyloid-mediated cytotoxicity; beta-amyloid aggregation and development of senile plaques in Alzheimer's and other neurodegenerative diseases.
Sequence: NELPQDSQEVTCT
[Pro31]-Beta-Amyloid (1-42) - Cat# 62443
This beta-amyloid peptide (1-42) has Ile31 substituted with Pro31. Substitution of Ile31 by the helix-breaking amino acid; proline; completely abrogates the oxidative stress and neurotoxic properties of beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAPIGLMVGGVVIA
[Val33]-Beta-Amyloid (1-42) - Cat# 62442
This modified amino acids 1 to 42 fragment of the beta amyloid peptide has substitution of Gly33 to Val33. This peptide shows almost no neuronal toxicity compared to the native beta amyloid (1-42); as well as having significantly lowered levels of oxidized proteins. It does not form fibrils nearly as well as beta amyloid (1- 42); suggesting that Gly33 may be a possible site of free radical propagation processes and contributes to the peptide’s toxicity in Alzheimer’s disease brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIVLMVGGVVIA
[Asn 6;13;14] -Beta-Amyloid (1-42) - Cat# 61958-01
This is a modified beta-amyloid (1-42) peptide; with histidines at positions 6; 13 and 14 replaced by asparagines.
Sequence: DAEFRNDSGYEVNNQKLVFFAEDVGSNKGAIIGLMVGGVVIA
gp100 (25–33); human - Cat# 62589
This is amino acids 25 to 33 fragment of human melanoma antigen gp100. This H-2Db restricted epitope is recognized by T cells. The gp100-specific; H-2Db-restricted; CD8+ T cells are capable of recognizing B16 melanoma but not normal melanocytes. This peptide was used as an immunogen in multiple cancer immunotherapy studies.
Sequence: KVPRNQDWL
Acrylodan - Cat# 83305
|