Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Gastrins  >>  Big Gastrin-1, human

Product Name Big Gastrin - 1, human
Pyr - LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF - NH2
Size 0.5 mg
Catalog # AS-20747
US$ $259
Purity % Peak Area By HPLC ≥ 95%
Description

Big Gastrin is also referred to as Gastrin-34. Secretion of gastrin is induced by food intake and causes the release of gastric acid in the stomach. Secreted by the G cells in the gastric mucosa, it is one of the major bioactive forms of gastrin found in tissue and plasma (the other bioactive form is gastrin-17 or little gastrin - Cat# AS-20750). Both gastrin-17 and gastrin-34 are carboxy-amidated and partially tyrosine sulfated. Binding of gastrin to the CCK2/gastrin receptor requires carboxy-amidation, however sulfation is not necessary for binding to the receptor. Binding of Gastrin to the CCK2/gastrin receptors on parietal cells of the stomach causes them to secrete hydrochloric acid (HCl) and stimulates lectin-like protein Reg expression via activation of PKC and RhoA. Gastrin also plays a role in release of Histamine and Pepsinogen.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Choudhury, A. et al. Hoppe-Seylers Z Physiol Chem 361, 1719 (1980)
Niederle, B. Wien Klin Wochenschr 119, 561 (2007), doi: 10.1007/s00508-007-0897-x.
O’Connor A. et. al. Digestive Dis 32, 186 (2014), doi: 10.1159/000357848
Dockray, G. et.al. Pflügers Archiv 449,344 (2005)
Bundgaard, JR. et al. J Biol Chem 272, 21700 (1997), doi: 10.1074/jbc.272.35.21700
Yakabi, K. et al. World J Gastroenterol 14, 6334 (2008), doi: 10.3748/wjg.14.6334
Molecular Weight 3849.3
Sequence
(One-Letter Code)
Pyr-LGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF-NH2
Sequence
(Three-Letter Code)
pGlu - Leu - Gly - Pro - Gln - Gly - Pro - Pro - His - Leu - Val - Ala - Asp - Pro - Ser - Lys - Lys - Gln - Gly - Pro - Trp - Leu - Glu - Glu - Glu - Glu - Glu - Ala - Tyr - Gly - Trp - Met - Asp - Phe - NH2
     
  < Back