Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells.
Ref: Kamata, K. et al. Nephrol. Dialysis Transplantation 11, 1267 (1996); Tache, Y. et al. Gastroenterol. 81, 298 (1981); Siegfried, J. et al. J. Biol. Chem. 269, 8596 (1994); Patel, O. et al. Biochem. Pharmacol. 68, 2129 (2004).
Molecular Weight
2859.4
Sequence (One-Letter Code)
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Sequence (Three-Letter Code)
H - Val - Pro - Leu - Pro - Ala - Gly - Gly - Gly - Thr - Val - Leu - Thr - Lys - Met - Tyr - Pro - Arg - Gly - Asn - His - Trp - Ala - Val - Gly - His - Leu - Met - NH2
Material Safety Data Sheets (MSDS)
