Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Gastrins  >>  Gastrin Releasing Peptide, human

Product Name Gastrin Releasing Peptide, human
VPLPAGGGTVLTKMYPRGNHWAVGHLM - NH2
Size 1 mg
Catalog # 24214
US$ $193
Purity % Peak Area By HPLC ≥ 95%
Description

Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: Kamata, K. et al. Nephrol. Dialysis Transplantation 11, 1267 (1996); Tache, Y. et al. Gastroenterol. 81, 298 (1981); Siegfried, J. et al. J. Biol. Chem. 269, 8596 (1994); Patel, O. et al. Biochem. Pharmacol. 68, 2129 (2004).
Molecular Weight 2859.4
Sequence
(One-Letter Code)
VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Sequence
(Three-Letter Code)
H - Val - Pro - Leu - Pro - Ala - Gly - Gly - Gly - Thr - Val - Leu - Thr - Lys - Met - Tyr - Pro - Arg - Gly - Asn - His - Trp - Ala - Val - Gly - His - Leu - Met - NH2
     
  < Back