Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Nle35]-beta-Amyloid (1-42), Human

Product Name [Nle35] - beta - Amyloid (1 - 42), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL - Nle - VGGVVIA
Size 0.1 mg
Catalog # 23532-01
US$ $132
Purity % Peak Area By HPLC ≥ 95%
Description

This is an A (1-42) with the methionine residue at position 35 substituted by norleucine.

Detailed Information Datasheet
Storage -20C
Molecular Weight 4496.1
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-Nle-VGGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Nle - Val - Gly - Gly - Val - Val - Ile - Ala - OH
Product Citations Shoval, H. et al. BBA 1784, 1570 (2008).
     
  < Back