Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Pyr3]-beta-Amyloid (3-42), Human

Product Name [Pyr3] - beta - Amyloid (3 - 42), Human
Pyr - FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 1 mg
Catalog # 29907-1
US$ $290
Purity % Peak Area By HPLC ≥ 95%
Description

This is one of the predominant amyloid peptide structures deposited in human brain of Alzheimer’s disease and Down’s syndrome patients.

Detailed Information Datasheet
Brochure
Storage -20°C
References Ref: Russo, C. et al. Neurobiology Nature 405, 531 (2000).
Molecular Weight 4309.9
Sequence
(One-Letter Code)
Pyr-FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
Pyr - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
Product Citations Condic, M. et al. (2014). N-truncation and pyroglutaminylation enhances the opsonizing capacity of Aβ-peptides and facilitates phagocytosis by macrophages and microglia. Brain Behav Immun. doi: 10.1016/j.bbi.2014.05.003.
Piccini, A. et al. (2005). β-Amyloid is different in normal aging and in Alzheimer disease. J. Biol. Chem. 280, 34186.
     
  < Back