Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  Beta-Amyloid (5-42), Human

Product Name Beta - Amyloid (5 - 42), Human
RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 1 mg
Catalog # 60087-1
US$ $545
Purity % Peak Area By HPLC ≥ 95%
Storage -20C
Molecular Weight 4051.6
Sequence
(One-Letter Code)
RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
Product Citations Condic, M. et al. (2014). N-truncation and pyroglutaminylation enhances the opsonizing capacity of Aβ-peptides and facilitates phagocytosis by macrophages and microglia. Brain Behav Immun. doi: 10.1016/j.bbi.2014.05.003.
     
  < Back