Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Adrenomedullin Peptides  >>  Adrenomedullin (1-52), human

Product Name Adrenomedullin (1 - 52), human
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY - NH2 (Disulfide bridge: 16 - 21)
Size 0.5 mg
Catalog # 60447
US$ $335
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Datasheet
Storage -20C
Molecular Weight 6028.8
Sequence
(One-Letter Code)
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 (Disulfide bridge: 16-21)
Sequence
(Three-Letter Code)
H - Tyr - Arg - Gln - Ser - Met - Asn - Asn - Phe - Gln - Gly - Leu - Arg - Ser - Phe - Gly - Cys - Arg - Phe - Gly - Thr - Cys - Thr - Val - Gln - Lys - Leu - Ala - His - Gln - Ile - Tyr - Gln - Phe - Thr - Asp - Lys - Asp - Lys - Asp - Asn - Val - Ala - Pro - Arg - Ser - Lys - Ile - Ser - Pro - Gln - Gly - Tyr - NH2 (Disulfide bridge: 16 - 21)
     
  < Back