Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amylin Peptides  >>  Amylin (8-37), rat

Product Name Amylin (8 - 37), rat
Size 1 mg
Catalog # 21749
US$ $242
Purity % Peak Area By HPLC ≥ 95%
Description

This is a truncated peptide of native rat amylin. In-vivo and in-vitro studies suggest that it acts as a specific amylin antagonist. In isolated soleus muscle, it blocks amylin-induced inhibition of glycogen synthesis but has no effect in the absence of amylin. Amylin (8-37) increases whole body and muscle insulin sensitivity and consistently reduces basal insulin levels in normal and hGH-induced insulin-resistant rats. It also elicits a significant alteration of in-vivo lipid metabolism.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: Deems, RO. et al. Biochem. Biophys. Res. Commun. 181, 116 (1991); Hettiarachchi, M. et al. Am. J. Physiol. Endocrinol. Metab. 273, E859 (1997).
Molecular Weight 3200.6
Sequence
(One-Letter Code)
ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2
Sequence
(Three-Letter Code)
H - Ala - Thr - Gln - Arg - Leu - Ala - Asn - Phe - Leu - Val - Arg - Ser - Ser - Asn - Asn - Leu - Gly - Pro - Val - Leu - Pro - Pro - Thr - Asn - Val - Gly - Ser - Asn - Thr - Tyr - NH2
     
  < Back