Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Neuropeptide Y and Analogs  >>  Neuropeptide Y (3-36), human, rat

Product Name Neuropeptide Y (3 - 36), human, rat
SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY - NH2
Size 1 mg
Catalog # AS-22479
US$ $215
Purity % Peak Area By HPLC ≥ 95%
Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Ref: Grandt, D. et al. Regul. Pept. 67, 33 (1996); Shaw, C. et al. Regul. Peptides 45, 387 (1993).
Molecular Weight 4011.5
Sequence
(One-Letter Code)
SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2
Sequence
(Three-Letter Code)
H - Ser - Lys - Pro - Asp - Asn - Pro - Gly - Glu - Asp - Ala - Pro - Ala - Glu - Asp - Met - Ala - Arg - Tyr - Tyr - Ser - Ala - Leu - Arg - His - Tyr - Ile - Asn - Leu - Ile - Thr - Arg - Gln - Arg - Tyr - NH2
     
  < Back