Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Pancreatic Polypeptides  >>  Pancreatic Polypeptide, human

Product Name Pancreatic Polypeptide, human
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY - NH2
Size 1 mg
Catalog # AS-22867
US$ $215
Purity % Peak Area By HPLC ≥ 95%
Description

Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplisehd through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin and Obestatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY).

Storage -20C
References Williams, JA. Pancreapedia (2014), doi: 10.3998/panc.2014.4
Khandekar, N. et al. Mol Cell Endocrinol (2015), doi: 10.1016/j.mce.2015.06.028
Molecular Weight 4181.8
Sequence
(One-Letter Code)
APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
Sequence
(Three-Letter Code)
H - Ala - Pro - Leu - Glu - Pro - Val - Tyr - Pro - Gly - Asp - Asn - Ala - Thr - Pro - Glu - Gln - Met - Ala - Gln - Tyr - Ala - Ala - Asp - Leu - Arg - Arg - Tyr - Ile - Asn - Met - Leu - Thr - Arg - Pro - Arg - Tyr - NH2
     
  < Back