Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Account Login My Cart My Custom Reports My Favorites Logout
About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Pituitary Adenylate Cyclase Activating Peptides (PACAPS)  >>  PACAP (1-38), amide, human, ovine, rat
Product Name PACAP (1 - 38), amide, human, ovine, rat
Size 0.5 mg
Catalog # 22519
US$ $181
Purity % Peak Area By HPLC ≥ 95%
Description

This neuropeptide isolated from bovine hypothalmus is more active than Vasoactive Intestinal Peptide (VIP) in stimulating adenylate cyclase EC50=7nM.
Detailed Information Datasheet
Storage -20°C
References Ref: Miyata, A. et al. BBRC 173, 1271 (1990).
Molecular Weight 4534.3
Sequence
(One-Letter Code)		 HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Sequence
(Three-Letter Code)		 H - His - Ser - Asp - Gly - Ile - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - Gly - Lys - Arg - Tyr - Lys - Gln - Arg - Val - Lys - Asn - Lys - NH2
     
  < Back
Copyright © 2002-2011 AnaSpec, Inc. All rights reserved. | 65.39.186.246 (USA) | Site Map | Terms & Conditions