Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Pituitary Adenylate Cyclase Activating Peptides (PACAPS)  >>  PACAP (1-38), amide, human, ovine, rat

Product Name PACAP (1 - 38), amide, human, ovine, rat
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK - NH2
Size 1 mg
Catalog # 22520
US$ $313
Purity % Peak Area By HPLC ≥ 95%
Description

This neuropeptide isolated from bovine hypothalmus is more active than Vasoactive Intestinal Peptide (VIP) in stimulating adenylate cyclase EC50=7nM.

Detailed Information Datasheet
Storage -20C
References Ref: Miyata, A. et al. BBRC 173, 1271 (1990).
Molecular Weight 4534.3
Sequence
(One-Letter Code)
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Sequence
(Three-Letter Code)
H - His - Ser - Asp - Gly - Ile - Phe - Thr - Asp - Ser - Tyr - Ser - Arg - Tyr - Arg - Lys - Gln - Met - Ala - Val - Lys - Lys - Tyr - Leu - Ala - Ala - Val - Leu - Gly - Lys - Arg - Tyr - Lys - Gln - Arg - Val - Lys - Asn - Lys - NH2
Product Citations Roy, A. et al. (2013). Stress peptide PACAP engages multiple signaling pathways within the carotid body to initiate excitatory responses in respiratory and sympathetic chemosensory afferents. Am J Physiol Regul Integr Comp Physiol 304, R1070. doi: 10.​1152/​ajpregu.​00465.​2012 .
     
  < Back