Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Exendins  >>  Exendin (9-39)

Product Name Exendin (9 - 39)
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2
Size 1 mg
Catalog # AS-24468
US$ $363
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. It is a competitive inhibitor of Exendin-3 and Exendin-4.

Detailed Information Datasheet
Storage -20C
References Ref: Fehmann, HC. et al. Peptides 15, 453 (1994).
Molecular Weight 3369.8
Sequence
(One-Letter Code)
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(Three-Letter Code)
H - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
     
  < Back