Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Galanins  >>  Galanin, human

Product Name Galanin, human
Size 0.5 mg
Catalog # 22430
US$ $137
Purity % Peak Area By HPLC ≥ 95%
Description

Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20°C
References Ref: Wang, S. et al. J. Biol. Chem. 272, 31949 (1997).
Molecular Weight 3157.5
Sequence
(One-Letter Code)
GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
Sequence
(Three-Letter Code)
H - Gly - Trp - Thr - Leu - Asn - Ser - Ala - Gly - Tyr - Leu - Leu - Gly - Pro - His - Ala - Val - Gly - Asn - His - Arg - Ser - Phe - Ser - Asp - Lys - Asn - Gly - Leu - Thr - Ser - OH
Product Citations Kanazawa, T. et al. Clin Cancer Res 15 2222 (2009).
Misawa, K. et al. Clin Cancer Res 14, 7604 (2008).
Mazarati, Andréy. et al. J. Pharmacol. 318, 700 (2006).
Ahn, H. et al. Mol. Pharmacol. 51, 350 (1997).
     
  < Back