Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Glucagon-Like Peptides  >>  Glucagon (1-37), Oxyntomodulin, porcine

Product Name Glucagon (1 - 37), Oxyntomodulin, porcine
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Size 1 mg
Catalog # AS-22455
US$ $665
Purity % Peak Area By HPLC ≥ 95%
Description

Following nutrient ingestion, both GLP-1, and Oxyntomodulin (OXM) are processed from proglucagon and secreted from the gut endocine L-cells. Oxyntomodulin (OXM) a 37-amino acid peptide hormone causes weight loss in humans and rodents. It activates both the glucagon-like peptide-1 receptor (GLP1R) and the glucagon receptor (GCGR). It contains the same sequence as Glucagon (1-29), but with an additional KRNKNNIA C-terminal sequence.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Storage -20C
References Pocai A. Mol Metab 3, 241 (2014), doi:10.1016/j.molmet.2013.12.001
Molecular Weight 4421.9
Sequence
(One-Letter Code)
HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Sequence
(Three-Letter Code)
H - His - Ser - Gln - Gly - Thr - Phe - Thr - Ser - Asp - Tyr - Ser - Lys - Tyr - Leu - Asp - Ser - Arg - Arg - Ala - Gln - Asp - Phe - Val - Gln - Trp - Leu - Met - Asn - Thr - Lys - Arg - Asn - Lys - Asn - Asn - Ile - Ala - OH
     
  < Back