Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Antimicrobial and Related Peptides  >>  LL-37 pentamide

Product Name LL - 37 pentamide
Size 0.5 mg
Catalog # 61309
US$ $231
Purity % Peak Area By HPLC ≥ 95%
Description

This synthetic peptide is a modification of the LL-37 cathelicidin peptide in which each aspartic acid of LL-37 is replaced by an asparagine, and glutamic acid by glutamine. The anti-staphylococcal activity LL-37 pentamide is greater than that of LL-37 because multiple acidic residues of human LL-37 reduce its efficacy against Staphylococci.

Storage -20°C
References Zhao, C. et al. Antimicrob. Agents Chemother. 45, 2695 (2001).
Molecular Weight 4522.4
Sequence
(One-Letter Code)
LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS
Sequence
(Three-Letter Code)
H - Leu - Leu - Gly - Asn - Phe - Phe - Arg - Lys - Ser - Lys - Gln - Lys - Ile - Gly - Lys - Gln - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asn - Phe - Phe - Arg - Asn - Leu - Val - Pro - Arg - Thr - Gln - Ser - OH
     
  < Back