This synthetic peptide is a modification of the LL-37 cathelicidin peptide in which each aspartic acid of LL-37 is replaced by an asparagine, and glutamic acid by glutamine. The anti-staphylococcal activity LL-37 pentamide is greater than that of LL-37 because multiple acidic residues of human LL-37 reduce its efficacy against Staphylococci.
Storage
-20°C
References
Zhao, C. et al. Antimicrob. Agents Chemother. 45, 2695 (2001).
Molecular Weight
4522.4
Sequence (One-Letter Code)
LLGNFFRKSKQKIGKQFKRIVQRIKNFFRNLVPRTQS
Sequence (Three-Letter Code)
H - Leu - Leu - Gly - Asn - Phe - Phe - Arg - Lys - Ser - Lys - Gln - Lys - Ile - Gly - Lys - Gln - Phe - Lys - Arg - Ile - Val - Gln - Arg - Ile - Lys - Asn - Phe - Phe - Arg - Asn - Leu - Val - Pro - Arg - Thr - Gln - Ser - OH
