| Product Name |
RL - 37 |
| Size |
0.5 mg |
| Catalog # |
61313 |
| US$ |
$130 |
| Molecular Weight |
4100.9 |
Sequence
(One-Letter Code) |
RLGNFFRKVKEKIGGGLKKVGQKIKDFLGNLVPRTAS |
Sequence
(Three-Letter Code) |
H - Arg - Leu - Gly - Asn - Phe - Phe - Arg - Lys - Val - Lys - Glu - Lys - Ile - Gly - Gly - Gly - Leu - Lys - Lys - Val - Gly - Gln - Lys - Ile - Lys - Asp - Phe - Leu - Gly - Asn - Leu - Val - Pro - Arg - Thr - Ala - Ser - OH |
| Description |
RL-37, a 37-residue anti-microbial peptide of the cathelicidin family, is expressed in the bone marrow of rhesus monkey. In contrast to human LL-37, which has 5 acidic residues, RL-37 has only 2 and is considerably more potent against staphylococci than LL-37. |
| References |
Zhao, C. et al. Antimicrobial Agents Chemother. 45, 2695 (2001). |
| Storage |
-20°C |
| Detailed Information |
 Material Safety Data Sheets (MSDS)
|
