Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Antimicrobial and Related Peptides  >>  LL-37, reverse sequence

Product Name LL - 37, reverse sequence
SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
Size 0.5 mg
Catalog # AS-62208
US$ $143
Purity % Peak Area By HPLC ≥ 95%
Description

The reverse sequence of LL-37 (see Cat# 61302).

Storage -20°C
Molecular Weight 4493.3
Sequence
(One-Letter Code)
SETRPVLNRLFDKIRQVIRKFEKGIKEKSKRFFDGLL
Sequence
(Three-Letter Code)
H - Ser - Glu - Thr - Arg - Pro - Val - Leu - Asn - Arg - Leu - Phe - Asp - Lys - Ile - Arg - Gln - Val - Ile - Arg - Lys - Phe - Glu - Lys - Gly - Ile - Lys - Glu - Lys - Ser - Lys - Arg - Phe - Phe - Asp - Gly - Leu - Leu - OH
Product Citations Kahlenberg, JM. et al. (2013). Neutrophil extracellular Trap–associated protein activation of the NLRP3 inflammasome is lnhanced in lupus macrophages. J Immunol 190, 1217. doi: 10.4049/​jimmunol.1202388.
     
  < Back