Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Beta-Amyloid (8-40), Human

Product Name Beta - Amyloid (8 - 40), Human
SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 1 mg
Catalog # AS-61975
US$ $325
Purity % Peak Area By HPLC ≥ 95%
Description

This peptide is b-Amyloid 8 to 40 amino acids fragment. Angiotensin-converting enzyme (ACE) genotype has been shown to be associated with Alzheimer's disease (AD) in some populations. ACE degrades b-Amyloid by cleaving -?Amyloid 1 to 40 between Asp7-Ser8. Compared with b-Amyloid 1 to 40, aggregation and cytotoxic effects of the degradation products b-Amyloid 1 to 7 and b-Amyloid 8 to 40 peptides are reduced or virtually absent.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Hu, J. et al. J. Biol. Chem. 276, 47863 (2001).
Molecular Weight 3459
Sequence
(One-Letter Code)
SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back