Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Gly22]-beta-Amyloid (1-42), E22G Arctic Mutation, Human

Product Name [Gly22] - beta - Amyloid (1 - 42), E22G Arctic Mutation, Human
DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
Size 0.5 mg
Catalog # AS-61967-05
US$ $423
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.

Detailed Information Datasheet
Storage -20°C
References Yamamoto, N. et al. J. Biol. Chem. 282, 2646 (2007), Van Nostrand, W. et al. J. Biol. Chem. 276, 32860 (2001).
Molecular Weight 4442.1
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Gly - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back