This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Yamamoto, N. et al. J. Biol. Chem. 282, 2646 (2007), Van Nostrand, W. et al. J. Biol. Chem. 276, 32860 (2001).
Molecular Weight
4442.1
Sequence (One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
Sequence (Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Gly - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
Datasheet
