Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amyloid Peptides  >  Beta-Amyloid Peptides - Mouse/Rat  >>  Beta-Amyloid (11-40), mouse, rat

Product Name Beta - Amyloid (11 - 40), mouse, rat
Size 1 mg
Catalog # 62997
US$ $303
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 11 to 40 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid fragment by one amino acid residue: His13 in human beta-amyloid corresponds to Arg13 in mice and rat sequence.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Wang, R. et al. J. Biol. Chem. 271, 31894 (1996); Kowalik-Jankowska,T. et al. J. Inorg. Chem. 92, 1 (2002).
Molecular Weight 3170.7
Sequence
(One-Letter Code)
EVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Glu - Val - Arg - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back