Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Beta-Amyloid (5-40), Human

Product Name Beta - Amyloid (5 - 40), Human
RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 1 mg
Catalog # AS-62964
US$ $325
Purity % Peak Area By HPLC ≥ 95%
Description

This is amino acids 5 to 40 fragment of the beta-amyloid peptide. This amino-truncated amyloid peptide produced from caspase-cleaved amyloid precursor protein is deposited in Alzheimer’s disease brain. Cleavage between Phe4 and Arg5 is not mediated by BACE1.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Takeda, K. et al. FASEB J. 18, 1755 (2004).
Molecular Weight 3867.4
Sequence
(One-Letter Code)
RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back