Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Asp37]-beta-Amyloid (1-42), Human

Product Name [Asp37] - beta - Amyloid (1 - 42), Human
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVDGVVIA
Size 0.5 mg
Catalog # 62444
US$ $291
Purity % Peak Area By HPLC ≥ 95%
Description

This is beta-amyloid peptide amino acids 1 to 42 where Gly37 is replaced by the negatively charged Asp. This substitution completely abolishes neurotoxic and oxidative processes associated with the parent peptide, resulting in the lack of cell toxicity and protein oxidation in contrast to those observed in the native beta-amyloid 1 to 42. G37D peptide does not display the aggregation properties that are associated with native beta-amyloid.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Butterfield, DA. Free Rad. Res. 36, 1307 (2002); Kanski, J. et al. Neurotox. Res. 4, 219 (2002).
Molecular Weight 4572.2
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVDGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Asp - Gly - Val - Val - Ile - Ala - OH
     
  < Back