Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Asn7]-beta-Amyloid (1-42), Tottori-Japanese Mutation, Human

Product Name [Asn7] - beta - Amyloid (1 - 42), Tottori - Japanese Mutation, Human
DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Size 0.5 mg
Catalog # AS-63324
US$ $264
Purity % Peak Area By HPLC ≥ 95%
Description

This b-amyloid (1-42) contains the Tottori-Japanese (D7N) mutation where Asp7 is replaced by Asn7. In vitro analysis using beta-amyloid 1 to 40-based mutant peptide reveals that the D7N mutation does not accelerate the nucleation phase but selectively promotes the elongation phase of amyloid fibril formation. The levels of protofibrils generated from D7N beta-amyloid were markedly inhibited despite enhanced fibril formation.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Hori, Y. et al. J. Biol. Chem. 282, 4916 (2007).
Molecular Weight 4513.1
Sequence
(One-Letter Code)
DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asn - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back