Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyteŽ Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Asn7]-beta-Amyloid (1-42), Tottori-Japanese Mutation

Product Name [Asn7] - beta - Amyloid (1 - 42), Tottori - Japanese Mutation
Size 0.5 mg
Catalog # 63324
US$ $264
Purity % Peak Area By HPLC ≥ 95%
Description

This b-amyloid (1-42) contains the Tottori-Japanese (D7N) mutation where Asp7 is replaced by Asn7. In vitro analysis using beta-amyloid 1 to 40-based mutant peptide reveals that the D7N mutation does not accelerate the nucleation phase but selectively promotes the elongation phase of amyloid fibril formation. The levels of protofibrils generated from D7N beta-amyloid were markedly inhibited despite enhanced fibril formation.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20°C
References Hori, Y. et al. J. Biol. Chem. 282, 4916 (2007).
Molecular Weight 4513.1
Sequence
(One-Letter Code)
DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asn - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back