Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Fluorescent Labeled Peptides  >>  Beta-Amyloid (1-40), HiLyte Fluor™ 488-labeled

Product Name Beta - Amyloid (1 - 40), HiLyte Fluor™ 488 - labeled
Size 0.1 mg
Catalog # 60491-01
US$ $220
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fluorescent (HiLyte Fluor™ 488)-labeled ß-Amyloid peptide, Abs/Em=503/528 nm.

Detailed Information Datasheet
Material Safety Data Sheets (MSDS)
Brochure
Storage -20°C
Molecular Weight 4686.3
Sequence
(One-Letter Code)
HiLyte Fluor™ 488-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
HiLyte Fluor™ 488 - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Product Citations Carlo, A-S. et al. (2013). The pro-neurotrophin receptor Sortilin is a major neuronal apolipoprotein E receptor for catabolism of amyloid-β peptide in the brain. J Neurosci 33, 358. doi: 10.1523/​JNEUROSCI.2425-12.2013.
Hamada, T. (2010). Biomimetic Microdroplet Membrane Interface: Detection of the Lateral Localization of Amyloid Beta Peptides. J Phys Chem Lett 1, 170.
Meier, M. et al. (2009). Plug-based microfluidics with defined surface chemistry to miniaturize and control aggregation of amyloidogenic peptides. Angew Chem Int Ed 48, 1.
Morita, M. et al. (2009). Real-time observation of model membrane dynamics induced by Alzheimer's amyloid beta. Biophys Chem 147, 81.
Petersen, CAH. et al. (2008). The amyloid β-peptide is imported into mitochondria via the TOM import machinery and localized to mitochondrial cristae. PNAS 105, 13145.
     
  < Back