Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Fluorescent Labeled Peptides  >>  Exendin 4, FAM-labeled

Product Name Exendin 4, FAM - labeled
FAM - HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2
Size 1 mg
Catalog # 60280-1
US$ $726
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fluorescent (FAM)-labeled Exendin 4, Abs/Em = 494/519 nm.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4545
Sequence
(One-Letter Code)
FAM-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Sequence
(Three-Letter Code)
FAM - His - Gly - Glu - Gly - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2
     
  < Back