Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Fluorescent Dyes  >  Fluorescent Biopolymers  >>  Beta-Amyloid (1-40), Rhodamine Green-labeled, Human

Product Name Beta - Amyloid (1 - 40), Rhodamine Green - labeled, Human
Rhodamine Green - DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 0.1 mg
Catalog # 61134
US$ $115
Purity % Peak Area By HPLC ≥ 95%
Description

This is a fluorescent (Rhodamine Green)-labeled -Amyloid peptide, Abs/Em=502/527 nm.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4686.2
Sequence
(One-Letter Code)
Rhodamine Green-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
Rhodamine Green - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back