Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Fluorescent Dyes  >  Fluorescent Biopolymers  >>  Beta-Amyloid (11-40), Human

Product Name Beta - Amyloid (11 - 40), Human
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Size 1 mg
Catalog # AS-60017-1
US$ $385
Purity % Peak Area By HPLC ≥ 95%
Description

Post-mortem Alzheimers diseased brain specimens reveals significant levels of A (11-40/42) within insoluble amyloid pools. The -secretase enzyme or -amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of A, ultimately leading to the production of full-length A (1-40/42) or truncated A (11-40/42). The abundance of A (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.

Storage -20C
References Ref: Huse, JT. et al. J. Biol. Chem. 277, 16278 (2002); Qahwash, I. et al. J. Biol. Chem. 279, 39010 (2004); Liu, K. et al. Biochem. 41, 3128 (2002).
Molecular Weight 3151.7
Sequence
(One-Letter Code)
EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
     
  < Back