Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

About AnaSpec Ordering & Shipping Technical Notes contact us
Smart Search
Peptides
Fluorescent Dyes & Quenchers
SensoLyte® Assay Kits
Antibodies
AnaTag? Protein Labeling Kits
Enzymes and Other Proteins
Amino Acids
Synthesis Reagents, Resins & Accessories
qPCR & qRT-PCR Reagents
Oligonucleotides
Cloning & Expression and Gene Analysis
Subscribe to AnaSpec Announcements
Email:
Research Topics

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-40) and Related Peptides  >>  Beta-Amyloid (1-40)

Product Name Beta - Amyloid (1 - 40)
Size 5 mg
Catalog # 24236-5
US$ $1045
Purity % Peak Area By HPLC ≥ 95%
Description

Aß (1-40) together with Aß (1-42) are two major C-terminal variants of the Aß protein constituting the majority of Aßs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.





Electron microscopy of b-amyloid (1-40) stained with Thioflavin T (data generated by an AnaSpec scientist).

Detailed Information Datasheet
Brochure
Storage -20°C
References Ref: Masters, CL. et al. Proc. Natl. Acad. Sci. USA 82, 4245 (1985); Yankner, BA. Neuron 16, 921 (1996); Geula, C. et al. Nat. Med. 4, 827 (1998); Shin, R. et al. J. Neurosci.17, 8187 (1997).
Molecular Weight 4329.9
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Product Citations Ohta, H. et al. (2012). Effects of NK-4 in a transgenic mouse model of alzheimer's disease. Plos One doi:10.1371/journal.pone.0030007
Takahashi, E. et al. (2012). Quantitation of amyloid beta peptides in CSF by surface enhanced MALDI-TOF. SELDI-TOF Mass Spectro doi: 10.1007/978-1-61779-418-6_16
Takata, K. et al. (2012). Microglial amyloid-β1-40 phagocytosis dysfunction is caused by high-mobility group box protein-1: Implications for the pathological progression of Alzheimer’s Disease. Intl J Alz Dis doi:10.1155/2012/685739
"Tundo, G. et al. (2012). Somatostatin modulates insulin-degrading-enzyme metabolism: Implications for the regulation of microglia activity in AD. Plos One doi:10.1371/journal.pone.0034376
Choi, JS. et al. (2011). Synthesis and characterization of IMPY derivatives that regulate metal-induced amyloid-β aggregation. Metallomics 3, 284.
Dillen, L. et al. (2011). A screening UHPLC–MS/MS method for the analysis of amyloid peptides in cerebrospinal fluid of preclinical species. Bioanalysis 3, 45.
Libeu, CP. et al. (2011). Structural and functional alterations in amyloid-β precursor protein induced by amyloid-β peptides. J Alzheimer's Dis 25, 547.
Soto-Ortega, D. et al. (2011). Inhibition of amyloid-β aggregation by coumarin analogs can be manipulated by functionalization of the aromatic center. Bioorg Med Chem 19, 25996.
Vivekanandan, S. et al. (2011). A partially folded structure of amyloid-beta(1-40) in an aqueous environment. Biochem Biophys Res Commun 10.1016/j.bbrc.2011.06.133.
Hoi, C. et al. (2010). Neuroprotective effect of honokiol and magnolol, compounds from Magnolia officinalis, on beta-amyloid-induced toxicity in PC12 cells. Phytother Res 10.1002/ptr.3178.
Keshet, B. et al. (2010). Can size alone explain some of the differences in toxicity between -amyloid oligomers and fibrils? Biotech Bioengineer 106, 333.
Ravindran, C. et al. (2010). CpG-ODNs induces up-regulated expression of chemokine CCL9 in mouse macrophages and microglia. Cell Immunol 260, 113.
Reza, M. et al. (2010). Microchip electrophoresis profiling of Aβ peptides in the cerebrospinal fluid of patients with Alzheimer’s disease. Anal Chem 82, 7611.
Vargas, T. et al. (2010). Gelsolin restores Aβ-induced alterations in choroid plexus epithelium. J Biomed Biotech 10.1155/2010/805405.
Liu, L. et al. (2009). Differential modification of Cys10 alters transthyretin's effect on beta-amyloid aggregation and toxicity. PEDS 10.1093/protein/gzp025.
Lin, MS. et al. (2009). Dynamic fluorescence imaging analysis to investigate the cholesterol recruitment in lipid monolayer during the interaction between β-amyloid (1–40) and lipid monolayers. Colloids Surf B 74, 59.
Muresan, V. et al. (2009). The cleavage products of amyloid-β precursor protein are sorted to distinct carrier vesicles that are independently transported within neurites. J Neurosci 29, 3565.
Andras, IE. et al. (2008). Simvastatin protects against amyloid β and HIV-1 tat-induced promoter activities of inflammatory genes in brain endothelial cells. Mol Pharmacol 73, 1424.
Ho, C. et al. (2008). Bio-assay guided isolation and identification of anti-Alzheimer active compounds from the root of Angelica sinensis. Food Chem 114, 246.
Minicozzi, V. et al. (2008). Identifying the minimal copper- and zinc-binding site sequence in amyloid-β peptides. J Biol Chem 283, 10784.
Shimojo, M. et al. (2008). Enzymatic characteristics of I213T mutant presenilin-1/ γ-secretase in cell modles and knock-in mouse brains. J Biol Chem 283, 16488.
Guo, J. et al. (2006). Aβ and tau form soluble complexes that may promote self aggregation of both into the insoluble forms observed in Alzheimer’s disease. PNAS 103, 1953.
Edwin, NJ. et al. (2005). Elucidating the kinetics of β-amyloid fibril formation. New Polymeric Mater 10.1021/bk-2005-0916.ch009.
Inaba, S. et al. (2005). Specific binding of amyloid-β-protein to IMR-32 neuroblastoma cell membrane. J Pept Res 65, 485.
Boros, S. et al. (2004). Transglutaminase catalyzes differential crosslinking of small heat shock proteins and amyloid-β. FEBS Lett 576, 57.
Sun, Z. et al. (2005) Cholesterol depletion inhibits the degradation of amyloid β-peptide in rat pheochromocytoma (PC12) cells. Neurosci Lett 391, 71.
Cottingham, MG. et al. (2004). Rapid method for measurement of surface tension in multiwell plates. Lab Invest 84, 523.
Kim, J. et al. (2003). Targeted control of kinetics of β-amyloid self-association by surface tension-modifying peptides. J Biol Chem 278, 40730.
Arispe, N. et al. (2002). Plasma membrane cholesterol controls the cytotoxicity of Alzheimer's disease AβP (1-40) and (1-42) peptides. FASEB J 16, 1526.
Klegeris, A. et al. (2001). Inflammatory cytokine levels are influenced by interactions between THP-1 monocytic, U-373 MG astrocytic, and SH-SY5Y neuronal cell lines of human origin. Neurosci Lett 313, 41.
Lowe, T. et al. (2001). Structure−function relationships for inhibitors of &$946;-amyloid toxicity containing the recognition sequence KLVFF. Biochem 40, 7882.
Liang, J. et al. (2000). Interaction between β-amyloid and lens αB-crystallin. FEBS Lett 484, 98.
Satoh, K. et al. (2000). Expression of prostaglandin E synthase mRNA is induced in beta-amyloid treated rat astrocytes. Neurosci Lett 283, 221.
     
  < Back