Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  HIV Related Peptides  >>  Prostatic Acid Phosphatase (248-286), PAP (248-286)

Product Name Prostatic Acid Phosphatase (248 - 286), PAP (248 - 286)
GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
Size 1 mg
Catalog # AS-64518
US$ $330
Purity % Peak Area By HPLC ≥ 95%
Description

Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
Molecular Weight 4551.5
Sequence
(One-Letter Code)
GIHKQKEKSRLQGGVLVNEILNHMKRATQIPSYKKLIMY
Sequence
(Three-Letter Code)
H - Gly - Ile - His - Lys - Gln - Lys - Glu - Lys - Ser - Arg - Leu - Gln - Gly - Gly - Val - Leu - Val - Asn - Glu - Ile - Leu - Asn - His - Met - Lys - Arg - Ala - Thr - Gln - Ile - Pro - Ser - Tyr - Lys - Lys - Leu - Ile - Met - Tyr - OH
     
  < Back