Login
Existing Account

Please login first to complete purchase/ quotation request, view custom order reports, or create favorites list.

Customer ID:
Password:
Stay Logged In


Forgot your Customer ID or Password?
New Account

Don't have an account with us yet? Please set up an account to place order or obtain customer services.

Peptides  >  Amyloid Peptides  >  Beta-Amyloid (1-42) and Related Peptides  >>  [Cys20]-beta-Amyloid (1-42), Human

Product Name [Cys20] - beta - Amyloid (1 - 42), Human
DAEFRHDSGYEVHHQKLVFCAEDVGSNKGAIIGLMVGGVVIA
Size 1 mg
Catalog # 65175
US$ $385
Purity % Peak Area By HPLC ≥ 95%
Description

This is beta-amyloid (1-42) with substitution of Phe20 to Cys. Cysteine substitutions are used to study the structure and stabilization of amyloid fibrils.

Detailed Information Material Safety Data Sheets (MSDS)
Storage -20C
References Shivaprasad, S. and R. Wetzel J Biol Chem 281, 993 (2006).
Molecular Weight 4470.1
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFCAEDVGSNKGAIIGLMVGGVVIA
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Cys - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - OH
     
  < Back